About Services Plasmids Contact

POPTR_0019s13170g

Gene
POPTR_0019s13170g
Protein
CASP-like protein 1C2
Organism
Populus trichocarpa
Length
162 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
17.543 kDa
Sequence
MMKPKRLLSLLLRLIAVGATLAAVIIMATSHEKGTFFAVSYEAKYTDTPAFKYFVIANAIVTVYGFLVLFHPPGSPLWRLVLALDLVFTMLLISSISAALAVAQVGKNGNSRAGWLPVCGQVTKYCNQVTGALVAGLIALITYIILLLHSIYTFLNPLLEKA

Gene
POPTR_0019s13170g
Protein
CASP-like protein 1C2
Organism
Populus trichocarpa
Length
162 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
17.543 kDa
Sequence
MMKPKRLLSLLLRLIAVGATLAAVIIMATSHEKGTFFAVSYEAKYTDTPAFKYFVIANAIVTVYGFLVLFHPPGSPLWRLVLALDLVFTMLLISSISAALAVAQVGKNGNSRAGWLPVCGQVTKYCNQVTGALVAGLIALITYIILLLHSIYTFLNPLLEKA