About Services Plasmids Contact

POPTRDRAFT_824792

Gene
POPTRDRAFT_824792
Protein
CASP-like protein 1F1
Organism
Populus trichocarpa
Length
181 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
19.903 kDa
Sequence
MPNNEAKFSVNQPLKTQKLFIGVQIFFRIVAIAASVASSWLMITSKQVIDIGGIVLDARYSYSPEFKFLAFTNIVVGCFSLLSLLFLVLVVRQGSNPNHYFFLFLHDLAMMSLVVGGCAAATTVGFLGKHGNSHTGWMQICDNFGKFCNRAQTSVTISYLNLICLSILTITSASKSRKMEA