About Services Plasmids Contact

POPTRDRAFT_778555

Gene
POPTRDRAFT_778555
Protein
CASP-like protein 1C1
Organism
Populus trichocarpa
Length
164 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
18.037 kDa
Sequence
MGDVEIPPLVKQIVRGLRGLAFLATILATSFMAASHERAIFPFDYKADYTDLMLFKAFLGANIAASLYSFFFVCLPPKSLLWRLAIVLDVIMFGLLVAMDSAAIAAAYLHKHGDSQAFWPPICSQVPTYCYRVILAISIGFGGVFMFLLIIIISISVILNPLLV