About Services Plasmids Contact

POPTRDRAFT_553757

Gene
POPTRDRAFT_553757
Protein
CASP-like protein 3A1
Organism
Populus trichocarpa
Length
224 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
23.927 kDa
Sequence
MMMNGQKLAPAAEVAVQLPESKVAADNISGTMSGPLVGASGGGTTAAMRPFGRKAEVMHVLLRLLCIITSVAALSFMFTAQQSSTISIYGFMLPVQSKWSFSHSFEYLVGVSAAVAAHSLLQLLISMSRLLRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPNFCKPLQSFCDHVAVSIFFTFTSCFLLAASAVQEVIWLSRSKY