polr3d

DNA-directed RNA polymerase III subunit rpc4

430 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs (By similarity).

Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

47.075 kDa

MSEPPQPPGKPSANAPKPAPRLKSIKPTTPGDANKITTPTIPSIKTKKEFKPNIPTARKKKDEKDPLSGAISDLISASLSPLAVVGDRPGKPNATSSGKFRSNLNPNRKKPAAIPITNLFQTPLVQAETQQPQSTYEMNKKNEKKDSDLLAQLFHEMEVDPMQPFHPTHLPLVDPRKIMKAYSLDDASKDLNETKRELEEKIKNGELSDTTNFTLNSIGSEDNNNNGGGSGQVKFVESSKKKNKEISTKDKPFYVEDQFLNKDKLFFIQLPNLLPSTQSKPNFNIPNPVLPPPKPTTITKTVTNPDGSITTTTIPINENTKIEDQPPPPPKELDEKAFVPVIYPGDFPPSIKEMPSGKLGTLKIYKSGKSILKIGTVEYDISSGDKLKFLEEVQCFQTKGGPDNSPTCYTLGIPSQHLVAAPIISQISGI

POLR3D

DNA-directed RNA polymerase III subunit RPC4

398 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).

Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

44.549 kDa

MSEGNAAGEPSAPGGPRPLLSGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQRDSHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDVGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLRNDIRNMPVQLPLAHSGWLFKEENEETDVKPRLAGPKEEDMEVDMPAVKVKEEPRDEDEEAKMKAPLRAARKIPGLPKDVSVAELLRELSLTQEEELLFLQLPDSLPGQPPTQDIKPIKTEVQSEDGQMVVIKQEKDREARLAENTCTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGDMTVLGHIKHKLVCSPNFESLLDHRHR

POLR3D

DNA-directed RNA polymerase III subunit RPC4

398 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).

Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

44.396 kDa

MSEGNAAGEPSTPGGPRPLLTGARGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTVKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFLDDPGLRNDTRNMPVQLPLAHSGWLFKEENDEPDVKPWLAGPKEEDMEVDIPAVKVKEEPRDEEEEAKMKAPPKAARKTPGLPKDVSVAELLRELSLTKEEELLFLQLPDTLPGQPPTQDIKPIKTEVQGEDGQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

Polr3d

DNA-directed RNA polymerase III subunit RPC4

398 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).

Belongs to the eukaryotic RPC4/POLR3D RNA polymerase subunit family.

44.357 kDa

MSEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEEPKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDMGPSHIINIKKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEESEEPEAKPFSAGPKEEDMEVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPPTQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTMGTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR