POLR1D

DNA-directed RNA polymerases I and III subunit RPAC2

133 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

15.182 kDa

MEEDQELERKMSGVKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQRGLTDLMNVCQHVLDKFEASIKEYKDQKASRNEATF

POLR1D

DNA-directed RNA polymerases I and III subunit RPAC2

133 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

15.237 kDa

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Polr1d

DNA-directed RNA polymerases I and III subunit RPAC2

133 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

15.072 kDa

MEDDQELERKISGLKTSMAEGERKTALEMVQAAGTDRQCVTFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLNVCQHVLVKFEASIKDYKAKKASKKEPTF

POLR1D

Protein POLR1D, isoform 2

122 amino acids

14.332 kDa

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

polr1d

DNA-directed RNA polymerases I and III subunit RPAC2

114 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity).

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

13.125 kDa

MAAETERKTTLEMVQAQGNEESCVTFVLHEEDHTLGNSLRYMVMKNPEVEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLNELVDVCQHVLNTFETSIKEYKEQKEAAME

polr1d

DNA-directed RNA polymerases I and III subunit RPAC2

112 amino acids

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively (By similarity).

Belongs to the archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family.

12.755 kDa

MAELGQKHALEMVRTDGADEGCVTFVLNEEDHTLGNSLRYMIMKSQDVEFCGYSITHPSESKINFRIQTRDGVPASEPLRNGLNNLTDVCKHVLQTFEARMKEFKEQEESMT