About Services Proteins Contact

PMT9312_0224

Gene
PMT9312_0224
Protein
Probable aspartoacylase
Organism
Prochlorococcus marinus (strain MIT 9312)
Length
301 amino acids
Similarity
Belongs to the AspA/AstE family. Aspartoacylase subfamily.
Mass
34.801 kDa
Sequence
MTVQRILIVAGTHGNEINPIWAVKQFNRNENSLKHGIEYEYIIGNPIAYEKGCRYIDADLNRSFKKSKNYDQNENSFYEISRANFLVDQFGINGSKPCQIAIDLHTTTANMGTSIVMYGRRFKDFCLAALLQNKFGLPIYLHEKDKSQTGFLVEAWPCGLVIEIGAVAQNFYDPKIINRFLIIISSLRDEIDKLKKNLIELPKDLVVHVHQGSVDYPRDEKGDIDGLIHPKRINRDWKMIKKGDPLFLNSQGIIYKYDGDQFIWPVFIGEVAYKEKQIAMSYTNKEVICSKNEWVQEFHRL