About Services Proteins Contact

PMM0411

Gene
PMM0411
Protein
Putative membrane protein insertion efficiency factor
Organism
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Length
78 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
9.006 kDa
Sequence
MFKTINKSITSILLFMISCYQKWFSPFFGPRCRFIPSCSSYGYEAITRHGPWKGGWLTLRRLSRCHPLTPCGCDPVPD