Plscr2

Phospholipid scramblase 2

307 amino acids

May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Belongs to the phospholipid scramblase family.

34.052 kDa

MEAPRSGTYLPAGYAPQYPPAAVQGPPEHTGRPTFQTNYQVPQSGYPGPQASYTVSTSGHEGYAATRLPIQNNQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEGCE

PLSCR2

Phospholipid scramblase 2

297 amino acids

Isoform 1 has no prospholipid scramblase activity, due to the lack of a N-terminal proline-rich domain.

Belongs to the phospholipid scramblase family.

33.504 kDa

MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEGVPWMPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFERTR

PLSCR2

Phospholipid scramblase 2

293 amino acids

May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system (By similarity).

Belongs to the phospholipid scramblase family.

32.577 kDa

MDKQNVQMNPPHPGTNLTGPPGHIGYPGPQAGYAVPPPGYASPGPVGFPVQHQPVTGHPGAPTQVPWMPAPLPPLNCPPGLEYLTQIDQLLIHQQIELLEVLIGFETNNKYEIKNSLGQRIYFAAEDTDCCTRNCCGPSRPFTMRILDNMGREVITLERPLRCTSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTIQNERREDVLRISGPCVICSCCADIDFEVKSLDDKYVVGKISKHWTGLIKELFTDVDNFGIQFPLDLDVKMKAVMLGACFLIDFMFFEMTRGE