PLEKHO1

Pleckstrin homology domain-containing family O member 1

423 amino acids

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).

48.152 kDa

MEKNNSAKRGQQDGNQQSAQPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNVQEAFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSRQPGNMAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDASPEEHSTCEESFRVDLDKSVAQLAAGRRRSDSENVKLSEKGRSGTLPRHEVTSWDKPTQRKDSLDKGTVYTPQVPKKLSHSEKNKCASMEEILSRRDSAHRAVLRRGLEAHCTAAEPEQLSRLQELVALKLEKTQELLTEVKGYGEGKRKVKDCATSTTTSSSSSSSRSDCERILQESERLLGEASSTWSQARRVLQEVRELRDLYRQIELQQVDCNPKQSSQYRKSMM

PLEKHO1

Pleckstrin homology domain-containing family O member 1

409 amino acids

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation (By similarity).

46.395 kDa

MMKKNNSTKRGPQDGNHQCAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRVLDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSSDRASGLPRLWEKPDKGATYTPQAPKKLTATEKSRCASLEEILSQRDAVPAHTLQRRAEDPPTPIPHAPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKRKAKEPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTQHSQYRKSLM

PLEKHO1

Pleckstrin homology domain-containing family O member 1

409 amino acids

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

46.237 kDa

MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYISEKEVKDEKNIQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLAHSKQPGNTAPNLIFLAVSPEEKESWINALNSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPTSCAESFRVDLDKSVAQLAGSRRRADSDRIQPSADRASSLSRPWEKTDKGATYTPQAPKKLTPTEKGRCASLEEILSQRDAASARTLQLRAEEPPTPALPNPGQLSRIQDLVARKLEETQELLAEVQGLGDGKRKAKDPPRSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTTPHSQYRKSLM

Plekho1

Pleckstrin homology domain-containing family O member 1

408 amino acids

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation (By similarity).

45.997 kDa

MKKSGSGKRGPPDGNHQSAAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVKDEKNSQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKESWINALSSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPASCAESFRVDLDKSVAQLAGSRRRADSDRIQPSSQRASSLSRPWEKPDKGAPYTPQALKKFPSTEKSRCASLEEILSQRDTAPARPLHLQAEESLPPVPAQPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKRKAKDPPQSPPDSESEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTSQHSQYRKSLM

Plekho1

Pleckstrin homology domain-containing family O member 1

408 amino acids

Plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP). May function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). Appears to target ATM to the plasma membrane. Also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation (By similarity).

46.068 kDa

MKKSGSGKRGPPDGNHQSVAPEKVGWVRKFCGKGIFREIWKNRYVVLKGDQLYVSEKEVKDEKNSQEVFDLSDYEKCEELRKSKSRSKKNHSKFTLARCRQPGTTAPNLIFLAVSPEEKESWINALSSAITRAKNRILDEVTVEEDSYLAHPTRDRAKIQHSRRPPTRGHLMAVASTSTSDGMLTLDLIQEEDPSPEEPASCAESFRVDLDKSVAQLAGSRRRADSDRIRPSSHRASSLSRPWERPDKGAPYTPQALKKLPSTEKSRCASLEEILSQRDTAPAHPLHLQAEESPAPVPSQPGQLSRIQDLVARKLEKTQELLAEVQGLGDGKWKAKDPPRSPPDSQSEQLLLETERLLGEASSNWSQAKRVLQEVRELRDLYRQMDLQTPDSHLRQTSQHSQYRKSLM