pi4k2b

Phosphatidylinositol 4-kinase type 2-beta

501 amino acids

Contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

56.199 kDa

MMAECDPTDGEPGNGSGDSTPETNFLSSEVPAVLFEKTRSAPSLGLSLNPGAAVRISDSTESVLTELEADGSGEEALLLPGPAGSLSPRAGKEKRTRRNMLSSSSDNLASPGNSSGEFNHFPEDPEFGEIIQRAEQAIENGVFPERISQGSSGSYFVKDPKGKIIGVFKPKSEEPYGHLNPKWTKYFHKVCCPCCFGRGCLIPNQGYLSEAAASLVDQKLGLWIVPKTKVVHLASETFHYNAIDRAKSRGKKYALEKVPKVGRRFHRVGLPPKVGSFQLFVEGYHEADFWLRKFEAEPLPENMRKQLQSQFERLVVLDYVIRNTDRGNDNWLIKYEKPGDGELTEKESEWTDPKDSAIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVAFSQETRDLVLSRISDMNFVQDLCEDLYEMFRTDKGFDKTMFEKQMSVMRGQILNLTQALKDGKSPIQLVQMPRVVVERSRSGGQGRVVQLGNAFTQTFHCKRPFFTSW

pi4k2b

Phosphatidylinositol 4-kinase type 2-beta

495 amino acids

Contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

56.349 kDa

MEQKQTTEPRDSPPLLVLLDPAAEQLEVSAPHTPLSPQPQSARAAPGSAVRFFCDSAREEEAGEDEPLLKKPGPMSPRAVRKGRTRLSSSSDDRENMSSGHVENGEYNVILNDPEFADIIHRAEQAIESGVFPERISQGSSGSYFVKDPKGKIIGVFKPKSEEPYGHLNPKWTKYFHKICCPCCFGRGCLVPNQGYLSEAGAYLVDEKLGLGVVPKTKAVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGKKFHRIGLPPKVGSFQLFVDGYKEADYWLRKFETDPLPENTRKQLQSPFEKLVILDYVIRNTDRGNDNWLIRYDSQDDDELSEKGDSFPLKDWKEIKEPIIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSQETRDLILPRISDMNFIQDLCEDLYELFKTDKGFDKDTFEKQMSVMRGQILNLTQALKDGKTPIQLVQMPRVVVERSYSGSQGRIVQMSNAFTQTFHCRKPFFSSW

pi4k2b

Phosphatidylinositol 4-kinase type 2-beta

492 amino acids

Plays a role in the phosphorylation of phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol 1,4,5,-trisphosphate (PIP). Involved in the regulation of vesicular membrane trafficking (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

55.77 kDa

MEPKQTADARDSPPLLVFLEPAAEEVTAHTAPLSPNPQSARAAPGSAVRFFSDSAREEEAGEDEPLLKKSGPVSPRAARKGRTRLSSSSDRENMSGGHVGNGEFNVILDDLEFADIIHRAEQAIESGVFPERISQGSSGSYFVKDPKGKIIGVFKPKSEEPYGHLNPKWTKYFHKICCPCCFGRGCLVPNQGYLSEAGAYLVDEKLGLGVVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVDGYKEADYWLRKFETDPLPENTRKQLQCQFEKLVILDYVIRNTDRGNDNWLIRYDSQDDDELMEKGDDFPLKDWKEIKEPVIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSQETRDLILPRISDMNFVQDLCEDLYELFKTDKGFDKATFEKQMSVMRGQILNLTQALKDGKTPIQLVQMPRVVVERSCSGSQGRIVQMSNAFTQTFHCRKPFFSSW

PI4K2B

Phosphatidylinositol 4-kinase type 2-beta

481 amino acids

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

54.744 kDa

MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAGDEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVGIFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYIIRNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSVMRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSSW

PI4K2B

Phosphatidylinositol 4-kinase type 2-beta

479 amino acids

Contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

53.922 kDa

MESGSEEPDEQLLLLSEPALHAGPPAGRAAPGGAVRLRGEPGLEEEEEGEEDSGPEGDGEEEPLLRASGRGRRAGAARDKEPRVGAGHTGHAIDMNTFLDDPEFAEIITRAEQVIECGVLPERISQGSSGSYFVKDCKGKTIGVFKPKSEEPYGHLNPKWTKYFHKICCPCCFGRGCLVPNQGYLSEAGAYLVDDKLGLGVVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVAKKFNRIGLPPKVGSFQLFVEGYKEADYWLRKFETDPLPENTRKEFQSQFERLVILDYVIRNTDRGNDNWLVRYEKQDDGLNLSDKDIQWTVTEESTIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLSQAQVPFSQETRDLVLPRISDMNFVQDLCEDLHELFKTDKGFDKATFENQMSVMRGQILNLTQALKDGKSPIQLVQMPRVIVERSSTGSQGRIVHLSNAFTQTFHSRKPFFSSW

Pi4k2b

Phosphatidylinositol 4-kinase type 2-beta

477 amino acids

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

54.464 kDa

MPEPPRDIMAEACEATRPSEDEDEEREPLLPRVAWAQPRRGAPGSAVRLQADQGAAVLREPATEEPPVVSEDRSISASLSTELDRTRNAVSETNTFLEDPEFADVVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRTIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDTKLQLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKIGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFERLVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDDKQLLIRIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEETRNLILPFISDMNFVQDLCEDLYELFKTDKGFDRAAFESQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGGQGRVVHLGSSFTQTVHCRKPFFSSW

Pi4k2b

Phosphatidylinositol 4-kinase type 2-beta

469 amino acids

Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).

Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily.

53.478 kDa

MAEACEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADEGADVLREPATDEPPAVSGEGSISASLSTELDRTRTTSSETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAIDRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEKLVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPFHWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQALRDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW