About Services Proteins Contact

PHYPADRAFT_135270

Gene
PHYPADRAFT_135270
Protein
CASP-like protein 4C1
Organism
Physcomitrella patens subsp. patens
Length
199 amino acids
Similarity
Belongs to the Casparian strip membrane proteins (CASP) family.
Mass
22.104 kDa
Sequence
MESGSVANDSGPLNSTPDVHLYGKTAAMKQRRSNTMLFVFRLLTFSFSLAAVLVMGTNKQKIRSAPQYLEVAWHDFDPFRYVFAVNAIICVYSFVETWLAVYTLSRGTLLLPETFQVWFDYGHDQGFACLLFSANSVGIAMAQLLQSGSTLIQGQYYCSDAGAYCTQARVSIAMGFGAFLFLALSSFLTGLRVARWYLP