About Services Proteins Contact

PH0533

Gene
PH0533
Protein
Uncharacterized protein PH0533
Organism
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length
116 amino acids
Similarity
Belongs to the UPF0440 family.
Mass
13.23 kDa
Sequence
MRKVIHIGLPKLSEEELIEIGDIAQRVIIDYIFEHLAKSEVRDMEVTARINQGETLDLELEVYVEVPIFVRVDVESLIDEAIDKAYEVVERHLRKLAKGKGNEGREEAEEASGKSK