About Services Proteins Contact

PAM71-HL

Gene
PAM71-HL
Protein
Protein PAM71-homolog, chloroplastic
Organism
Arabidopsis thaliana
Length
359 amino acids
Function
Probable chloroplast-localized Mn(2+)/H(+) and/or Ca(2+)/H(+) antiporter regulating Ca(2+), Mn(2+) and pH homeostasis.
Similarity
Belongs to the GDT1 family.
Mass
37.929 kDa
Sequence
MKLTSLSKNANSTATAVTVSSIQKLPFLSLSETLPCPKSSRKPTFLPLRCRRRPKLDLLWGKFRVRASDAGVGSGSYSGGEEDGSQSSSLDQSPATSSESLKPRGPFPYSLSIALVLLSCGLVFSLITFVKGGPSSVLAAVAKSGFTAAFSLIFVSEIGDKTFFIAALLAMQYEKTLVLLGSMGALSLMTILSVVIGKIFQSVPAQFQTTLPIGEYAAIALLMFFGLKSIKDAWDLPPVEAKNGEETGIELGEYSEAEELVKEKASKKLTNPLEILWKSFSLVFFAEWGDRSMLATVALGAAQSPLGVASGAIAGHLVATVLAIMGGAFLANYISEKLVGYVGGALFLVFAAATFFGVF