About Services Proteins Contact

PA5225

Gene
PA5225
Protein
UPF0149 protein PA5225
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
184 amino acids
Similarity
Belongs to the UPF0149 family.
Mass
19.358 kDa
Sequence
MSTQNSAYSAFSSLLAEAAMPVSPAELHGHLLGRVCAGAGFDEAAWQHAAAELLGGAPGERLKAALSGLLGMVRQDFSAGEVAVVMLLPDDETPLAQRTEALGQWCQGFLAGFGLTAREGSLTGEAEEVLQDMAAIAQVQGQLEDSEDGETDYMEVMEYLRVAPLLLFAECGKPLEPAPKPSLH