About Services Proteins Contact

PA3693

Gene
PA3693
Protein
Macro domain-containing protein PA3693
Organism
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Length
173 amino acids
Mass
18.219 kDa
Sequence
MTEVRVWQGDITRLAVDAIVNAANSSLLGGGGVDGAIHRAAGAELVAACRLLHGCKTGEAKITRGFRLPAAHVIHTVGPVWRGGDNGEAELLASCYRRSLALAEQAGAASVAFPAISCGIYGYPLEQAAAIAVEEVCRQRPAHSSLEEIVLVAFDSSMAERYQRLLGERPVAR