About Services Proteins Contact

P9303_16141

Gene
P9303_16141
Protein
UPF0102 protein P9303_16141
Organism
Prochlorococcus marinus (strain MIT 9303)
Length
126 amino acids
Similarity
Belongs to the UPF0102 family.
Mass
14.77 kDa
Sequence
MMESTRKGCWGEERVLRLLRRRGWQLVSQRWSCRYGELDLVLEKQQRLLVVEVKSRRSRGLDLWGLSAFNKGKQLRLKRAIGCWLATHPYFAEHSLELVLALVPLPPSRNTLDWIRIDDLDIDAAD