About Services Proteins Contact

ORMDL3

Gene
ORMDL3
Protein
ORM1-like protein 3
Organism
Ailuropoda melanoleuca
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity).
Similarity
Belongs to the ORM family.
Mass
17.451 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNTGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Gene
ORMDL3
Protein
ORM1-like protein 3
Organism
Bos taurus
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity).
Similarity
Belongs to the ORM family.
Mass
17.495 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFILNTVSLMSVLIPKLPQLHGVRIFGINKY

Gene
ormdl3
Protein
ORM1-like protein 3
Organism
Danio rerio
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis.
Similarity
Belongs to the ORM family.
Mass
17.613 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLGIGLLHIILLSIPFVSVPVVWTLTNLIHNMCMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIILYFLTSFYTKYDRVHFVINTISLLTVLIPKLPQFHGVRLFGINKY

Gene
ORMDL3
Protein
ORM1-like protein 3
Organism
Homo sapiens
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.
Similarity
Belongs to the ORM family.
Mass
17.495 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Gene
Ormdl3
Protein
ORM1-like protein 3
Organism
Mus musculus
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity).
Similarity
Belongs to the ORM family.
Mass
17.477 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMTVLIPKLPQLHGVRIFGINKY

Gene
ORMDL3
Protein
ORM1-like protein 3
Organism
Pongo abelii
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity).
Similarity
Belongs to the ORM family.
Mass
17.481 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Gene
Ormdl3
Protein
ORM1-like protein 3
Organism
Rattus norvegicus
Length
153 amino acids
Function
Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling (By similarity).
Similarity
Belongs to the ORM family.
Mass
17.463 kDa
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHVVLLSIPFVSVPVVWTLTNLIHNLGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQVHFILNTVSLMSVLIPKLPQLHGVRIFGINKY