About Services Proteins Contact

ORF75

Gene
ORF75
Protein
Protein ORF75
Organism
Human herpesvirus 8 type P (isolate GK18)
Length
1296 amino acids
Mass
141.68 kDa
Sequence
MAYDVTGLWLESDLTADEEAFVSFYTSRTGTLTLVPGGTGGYYLLWITFRRPPTSREERERRDVEIQTVLAVLSPLLGYPHVIRRSPPRGSERVVSFGYGPNINHRPTTLSTELGVLLRELGLQEWARVEVGRHLVSKITQTLLEPHPPQFIRAFTQNTDLVPYEGLEVPEGPQPVARPHIEDDVIMQAVMISLGADLLPLAVQASTGDNYNVARYFVIPGRCTMERWPWNCARQAFGIHGAYTHVHSSVQRGIRGLGNLLFHSTLFPGGQTQGALTGLYATEPALGPRAHSRFRRIFAKGVQQAEMLQGAGVPTLGGFLKTVRTIATTPGNALAVCSISTTTSKECISLRRMIPQQTVVCLGRFEPTDGPDTYPNLYRDSSDNAVRILETLKLVQRLAKGPIFSGLNRSHDPAPVVRHLQALAPRTGLELFVSKLPDEVRAHLPADPAAGPDAVEAAVAEHFLNVYCSLVFAVVAESGAVPGDLGETPLEVLQRAARLCACQITVLGRTSEQPGIRIVDDLTGETTRVFSVDQPSSTPPSPWLALSDGVRVSGHPEDVDWGLFATGSTIHQLLRHATVGSKEFFTRHMDRCSNGLIAQQAGVGPLDIPVSDYHLVLHSSMLAERVAPRVPDTVEAITPSMANLLHKDFETWVKALPQELLPVPAWRGQAMAMGEQAYKMATNVSTGATYAITEALTNLMFSPVSKLQDVVLTGAVAWSPEDHQAGLLQECLFACKEFCRELGVALSISSAASSPTLSERHVRITQQQETVEVLPFNSVVFTSWAEVKGSRYRVTPDVKVEGNALVYLAVNQSCLIAGSTFEHNFLASRHPIPPLNPSTVASLFMLVKYLMSKRLIVSGHDIGDGGLLPSAIEMALAGCRGLQLSLPAHPNPLELMVSETPGALVEVPQVHLSEVLRAARDYRCVAHPLGTVGPEGQGNNVTILQNETVVFQETLTSLQVSWTSFSDEMWNLVTPPLHPLEDMHRKDLGRLEHHLGSLRAMCLGSQLRLFSCPTSPRRVAALVLPGSSAPYALMAALQNTGFEVATVTVEELKRGQSLSGFSGLITCLRTGCQASYASARGWVLALCNDPTCASTLTEFLNRPDTFSICCGEVGFQLLVALGVVGRSESSPYTYGPTPPQRWAVNLETNVSKLYDSHWLNIQIPQNTKSVFLRVLRGTVLPSWAQGEYLGVRYEQDALEYILRQRGEITLTYHGNAADETLPARHYPRNPTGNSTVAGLTSSDGRHAALIIDPSLMFHPWQWQHVPPDLTPLSMSPWAMAFQSIYLWSVKKINDHH

Gene
ORF75
Protein
Capsid-associated protein Vp91
Organism
Epiphyas postvittana nucleopolyhedrovirus
Length
826 amino acids
Function
Probable capsid-associated protein.
Mass
93.452 kDa
Sequence
MSDVVLLVLAIIFIIIFVLIYCTIFFEFDETTFSKRLHVLTEYAKRTNAEHPTPDVLGHVSDVYEHTYIVTWFNTNDLSVYHETVHDDTIEVFDFLEQKFSPAKSTVAQRVAPSASDPNAFVLTGDKSEVKMHCPQHFNFDYNQLKCVPINPCDTRAPGLYAMDEHLLDALVHSQHLDKDYTINAHLQHPTLYLRCLADGSYVVQECPDNYTFDAATSECKVNELCQGRPDGYVLDYFPETLLVNEFVECYESKHVVKQCPEQHVFDRQLMTCVQAHPCAFNGAGHTYITADIGDTQYFECLNNQESQLITCINRVRNTDGQYACSGDARCANLTDGTGQLVHMHVDDTFEYASGQLVCDNFEVISEIDCNTSDVLTNMLFLQKFKLETEFPRQVFDNGECVPATFNNVRVLNDTFPIQNVPNDYNIDMQTSIIGLTDMIPKLLAGDDLDDTFGQNVVLARDVGAVGLNPVTAEPIDCLGTQLFDVLDASRANICTESGDGVLKTLKFENGTFLSVFRDNLTGSDIDYKRFCAISYENSLKIVKSDHFERRILTNILQSDVCADLYTTMYQKYTTLARKYTTTPFQYTYTFVKPPPNIVVYAKNIQLKNATISKPAFDPFANKQIDNKNNLAKPLFDPFKNAVWYSEPDGGDGDHWGPDLPPPVQPDSEPDESEPEPEVSPLILDKKDLFYSCYYELPSFKLTSCYAENDVIIDAITDLRNNVTVDAECEPAKDLHYVLNAYAYTGNGVGCRSVFNDDGVAVIKEPIPSYVFANLNTQSNDGVHYNRHVHVKDGRYMACPDHLYDDVEFRCNVEADKLYYLDNMQF

Gene
ORF75
Protein
Uncharacterized protein ORF75
Organism
Ictalurid herpesvirus 1 (strain Auburn)
Length
423 amino acids
Mass
46.532 kDa
Sequence
MVNTLKSSQCVHCILEAYPPGAGPVSAIDERWIRIFMPGGETLMIDRRLVYEPGSPCTYHTGLDLVGAHIVPNNSFDFRDVETGRDLSDFRSCDFMEDVHPWFRVLLEITTDRLDGPHRGGETVVINFGRRGVPCGVYLCSHGVTASCITMGPPVQGMPETISITINPFGGWFSWLVLKPAGTGSRKPFANDLTRYLIRTSGFSTAGIDRFETRSPIILYGGGRWVLECVPHLHPTLTVAKESIECALDPGSIVVIWPGPALPVVRHVLETVLVDRVRDLVGTLAANFEDIFVHRVDDRRVTHRWVEIPKNAPRKKLSFTVTGHRPEVLAAMCGGGWRLGHTMPGMGFDTDLKVEPAPGVKLDGPPRQLHPEFLRAAMAKIEPLVAPIESELRGNTSLHAWTITVVALVGRFGILITALESLS

Gene
ORF75
Protein
Uncharacterized protein ORF75
Organism
Ostreid herpesvirus 1 (isolate France)
Length
236 amino acids
Mass
26.451 kDa
Sequence
MSFIVEKINCNSLPLKRKTRFAAGHDVYTPYDVVFEVGQTEAKVYTNLVVKSVPEGCAIIVAGRSGLMHGNGMRAIDDEITVGSEDELIITLTRKTGLDKRVVLKSETRVAQIIADTTQDVKLVELPISTYGLDVNHGDVPVYKFNTHWRLEAMPWLRDYQGNRNEVYLRLKSEHFNGIIDPDYKGDIIYMSETPFERLDELYVEVRQFSGETYLGGESPDNVVRGEGGFGSTGGH

Gene
ORF75
Protein
Uncharacterized protein ORF75
Organism
Acidianus filamentous virus 1 (isolate United States/Yellowstone)
Length
75 amino acids
Mass
8.788 kDa
Sequence
MHAKIEIEIEEEKDGSLILKYNGMKIGDLNDVNPADELRLVNELIKVREKEMSTSDINKEIEHRLAKLLAWYYTE

Gene
ORF75
Protein
Uncharacterized 6.3 kDa protein
Organism
Orgyia pseudotsugata multicapsid polyhedrosis virus
Length
55 amino acids
Mass
6.25 kDa
Sequence
MPGNLLAYYKLKLAKSVSKTVSALLCKCVAPEDNDGDRYLQFNNNCNFIYIYVVK