About Services Proteins Contact

ORF64

Gene
ORF64
Protein
Large tegument protein deneddylase
Organism
Human herpesvirus 8 type P (isolate GK18)
Length
2635 amino acids
Function
Large tegument protein that plays multiple roles in the viral cycle. During viral entry, remains associated with the capsid while most of the tegument is detached and participates in the capsid transport toward the host nucleus. Plays a role in the routing of the capsid at the nuclear pore complex and subsequent uncoating. Within the host nucleus, acts as a deneddylase and promotes the degradation of nuclear CRLs (cullin-RING ubiquitin ligases) and thereby stabilizes nuclear CRL substrates, while cytoplasmic CRLs remain unaffected. These modifications prevent host cell cycle S-phase progression and create a favorable environment allowing efficient viral genome replication. Participates later in the secondary envelopment of capsids. Indeed, plays a linker role for the association of the outer viral tegument to the capsids together with the inner tegument protein.
Similarity
Belongs to the herpesviridae large tegument protein family.
Mass
289.691 kDa
Sequence
MAAQPLYMEGMASTHQANCIFGEHAGSQCLSNCVMYLASSYYNSETPLVDRASLDDVLEQGMRLDLLLRKSGMLGFRQYAQLHHIPGFLRTDDWATKIFQSPEFYGLIGQDAAIREPFIESLRSVLSRNYAGTVQYLIIICQSKAGAIVVKDKTYYMFDPHCIPNIPNSPAHVIKTNDVGVLLPYIATHDTEYTGCFLYFIPHDYISPEHYIANHYRTIVFEELHGPRMDISRGVESCSITEITSPSVSPAPSEAPLRRDSTQSQDETRPRRPRVVIPPYDPTDRPRPPHQDRPPEQAAGYGGNKGRGGNKGRGGKTGRGGNEGRGGHQPPDEHQPPHITAEHMDQSDGQGADGDMDSTPANGETSVTETPGPEPNPPARPDREPPPTPPATPGATALLSDLTATRGQKRKFSSLKESYPIDSPPSDDDDVSQPSQQTAPDTEDIWIDDPLTPLYPLTDTPSFDITADVTPDNTHPEKAADGDFTNKTTSTDADRYASASQESLGTLVSPYDFTNLDTLLAELGRLGTAQPIPVIVDRLTSRPFREASALQAMDRILTHVVLEYGLVSGYSTAAPSKCTHVLQFFILWGEKLGIPTEDAKTLLESALEIPAMCEIVQQGRLKEPTFSRHIISKLNPCLESLHATSRQDFKSLIQAFNAEGIRIASRERETSMAELIETITARLKPNFNIVCARQDAQTIQDGVGLLRAEVNKRNAQIAQEAAYFENIITALSTFQPPPQSQQTFEVLPDLKLRTLVEHLTLVEAQVTTQTVESLQAYLQSAATAEHHLTNVPNVHSILSNISNTLKVIDYVIPKFIINTDTLAPYKQQFSYLGGELASMFSLDWPHAPAEAVEPLPVLTSLRGKIAEALTRQENKNAVDQILTDAEGLLKNITDPNGAHFHAQAVSIPVLENYVHNAGVLLKGEKSERFSRLKTAIQNLVSSESFITVTLHSTNLGNLVTNVPKLGEAFTGGPHLLTSPSVRQSLSTLCTTLLRDALDALEKKDPALLGEGTTLALETLLGYGSVQDYKETVQIISSLVGIQKLVRDQGADKWATAVTRLTDLKSTLATTAIETATKRKLYRLIQRDLKEAQKHETNRAMEEWKQKVLALDNASPERVATLLQQAPTAKAREFAEKHFKILLPVPADAPVQASPTPMEYSASPLPDPKDIDRATSIHGEQAWKKIQQAFKDFNFAVLRPADWDALAAEYQRRGSPLPAAVGPALSGFLETILGTLNDIYMDKLRSFLPDAQPFQAPPFDWLTPYQDQVSFFLRTIGLPLVRALADKISVQALRLSHALQSGDLQQATVGTPLELPATEYARIASNMKSVFNDHGLQVRSEVADYVEAQRADAHTPHVPRPKIQAPKTLIPHPDAIVADGLPAFLKTSLLQQEAKLLALQRADFESLESDMRAAEAQRKASREETQRKMAHAITQLLQQAPSAISGRPLSLQDPVGFLEGIIYDKVLERESYETGLEGLSWLEQTIKSITVYAPVEEKQRMHVLLDEVKKQRANTETALELEAAATHGDDARLLQRAVDELSPLRVKGGKAAVESWRQKIQTLKSLVQEAEQAGLLLATIDTVAGQAQETISPSTLQGLYQQGQEAMAAIKRFRDSPQLAGLQEKLAELQQYVKYKKQYLEHFEATQSVVFTAFPLTQEVTIPALHYAGPFDNLERLSRYLHIGQTQPAPGQWLLTLPTFDPTRPACVPAGGHEPPLHRQVVFSSFLEAQIRLALSVAGPVPGRGLPGTPQIRRGVEAAACFLHQWDEISRLLPEVLDTFFHNAPLPAESSSNAFLAMCVLTHLVYLAGRAVLGPREPEHAAPDAYPREVALAPRDLTYLLLAMWPSWISAILKQPSHAEAAHACLVTLPTMLKAVPYLTLEASAGPLPADMRHFATPEARLFFPARWHHVNVQEKLWLRNDFMSLCHRSPGRARIAVLVWAVTCLDPEVIRQLWSTLRPLTADESDTASGLLRVLVEMEFGPPPKTPRREAVAPGATLPPYPYGLATGERLVGQAQERSGGAGKMPVSGFEIVLGALLFRAPLRIFSTASTHRISDFEGGFQILTPLLDCCPDREPFASLAAAPRRTVPLGDPCANIHTPEEIQIFARQAAWLQYTFANYQIPSTDNPIPIVVLNANNNLENSYIPRDRKADPLRPFYVVPLKPQGRWPEIMTTATTPCRLPTSPEEAGSQFARLLQSQVSATWSDIFSRVPERLAPNAPQKSSQTMSEIHEVAATPPLTITPNKPTGTPHVSPEADPITERKRGQQPKIVADNMPSRILPSLPTPKPREPRITLPHALPVISPPAHRPSPIPHLPAPQVTEPKGVLQSKRGTLVLRPAAVIDPRKPVSAPITRYERTALQPPRTEGEGRRPPDTQPVTLTFRLPPTAPTPATAALETKTTPPSTPPHAIDISPPQTPPMSTSPHARDTSPPAEKRAAPVIRVMAPTQPSGEARVKRVEIEQGLSTRNEAPPLERSNHAVPAVTPRRTVAREIRIPPEIKAGWDTAPDIPLPHSSPESSPPTSPQPIRVDDKSPLPNLVERYARGFLDTPSVEVMSLENQDIAVDPGLLTRRIPSVVPMPHPIMWSPIVPISLQNTDIDTAKITLISFIRRIKQKVAALSASLAETVDRIKKWYL

Gene
ORF64
Protein
Large tegument protein deneddylase
Organism
Murid herpesvirus 4
Length
2457 amino acids
Function
Large tegument protein that plays multiple roles in the viral cycle. During viral entry, remains associated with the capsid while most of the tegument is detached and participates in the capsid transport toward the host nucleus. Plays a role in the routing of the capsid at the nuclear pore complex and subsequent uncoating. Within the host nucleus, acts as a deneddylase and promotes the degradation of nuclear CRLs (cullin-RING ubiquitin ligases) and thereby stabilizes nuclear CRL substrates, while cytoplasmic CRLs remain unaffected. These modifications prevent host cell cycle S-phase progression and create a favorable environment allowing efficient viral genome replication. Participates later in the secondary envelopment of capsids. Indeed, plays a linker role for the association of the outer viral tegument to the capsids together with the inner tegument protein.
Similarity
Belongs to the herpesviridae large tegument protein family.
Mass
273.538 kDa
Sequence
MALPASLAGFRIEGTASTNQADCKFGENAGAQCLSNCIIYLMSSYFNNEAPITETHDLNKVLKFGAELDSNLRKLGLLSPGQYAQLDHVPCYVQTRKWSGFIYTSAEMFGLLGMPADISDSCITSLRDLLTANYSNTIQYILYICGQKSGAIIIQGGRYTMFDPHCLKDIPESPAHVLSTSDPDALIKYVGGVSREYTACFLYFVPGHISPKNYIMSHYKVISFSDLHGSKIILEEYDLPTTNQSFCSSPQASSSPDPEVGSLLKYMSKAKRKRYPMSCGEEWTDANKKRKESGRTPPEKMTHPLPSPDIIDLTMDDDVIDLTGDDDMEDESEGDREAEPDRSGTSLPSVTLPNLAAVDQLLNSLTLPGHVPSFPALVDTDTGESYRLTRALHQLKNVLQQVLEIGVVSDSDYTPTEALNVLNYLMAWSKQLQIKNDDIKLLINSNLQIEKLFTLLKNNLISDPNLADHVQAKVCACLPAMHANRATDLQKILLHCKNLTRALEISKSSLDIKDIITTFTESFPQDFFCVCSVEEANNLVSTVQDLKRVVSNNMALTSEQDARFKALMLSVLNNTDPPASLGPIYLETETRTPLLSSAIQEAVKAIEKDTVETLSELISNIPSENAIETTFVPPVRTLLKNVTTLLTVINACVERAEIRTPEIDSSQQQLSYIGRELSKIIDETWPERAFREPVHVLDIFQKTSSHLNDLKKKMADSESLDKILSEINQTLKAIQDKAASPALINTLSDYIKNATVLAQASDPRLVEIQSQVTTLTTSTSYIESLLQKINIRTLPEVIPQLQAATKTEQGQLSLAAMNLSLIQITNSLINEALSSIHARSHNHLSNTFFNSLNSLMGLADIPGREDLIKTMESIMAVQEELVDCDDMECVEKGLTTFKYIKSSIRQYKFDKSFKTKIYLIITSEVRDLTKIKTDKQLEAWKQDVADFTPASIDDLNLFLDKAPTKTARSYATRQLKHFRDDLIKEQEMETETTPVPSTAEIERAIDLKIKATWDKILTNLRDLTFHHIAPGDWQVLLTVFNDHKSALFTKMGGELLKALQGLTAYVDSILTPLLASQLPQGQRYVAPNSDWVETFDQNVKYYLRTFHLPRVSEQLDDLERKTLLLTKLVKFTDLSQSLIGTHLEKDWSIYQKLFNSLLTVYNDHLIKTKTEVHAFLDKIASDPLLEPQAHPDLQKITQLFTEQEIIEINTLPDIFKESIKNNEKHYIASYQTEMKVFTSMVDAALAKKTQSTTEYNTHLLKIVNNMLVQAPPYAASHPISSDAISYITSLVRDKHLLEKLSYAESLKNFNWLSRLITIILTNCHPSHKQHLQTLLDEILSREQTLTPLVALEDNANQSPTERTLQAALTTLNVERVLGRATTFQKWKSQLQELEEAVKTTTQVSLLIQTISSLHDKTVTEMDPTILSSHSQALADKLKELLALKPSLDETTMSLFHGMKAYAQFKHYFVQHYVITQPKIFDAYPLSHHGTVSSSGGHQATKFNPLMRLKAFSMVTDVKKMSVWREINTTVDPTGHTFIPAPPTPAMPPIHYNVLFSSFLQAEAINLALNSNQPPTKKFGLLPGLMDARVGVQGAMLLDNQWNDISTNSAKLLDHYVRSELTPNSLTNSQFAAMTVFAHAMAMVTPHINSTRATIFPSKAIVLNQLQFLKLCLTMWPKFSGGLLRAPSFERVVQLARATLPTLLLSAPRNTLNHFLANNYRPTDTLPNTEALLFYPNQHPLVNLEKLLLTSSPFHALSTSVLNTRISMLVWGILSLSEAVLQQLWDSLYQESATFTTYIDLLRHLSAMNHKNSTLTTSTSLPQNNGPVVYSYGHTAGTTVATLEGSHPLDDGGQNIPMTLFEFVIFAIILKLKFHVFYTQEKALVNTQLGPLHLITHALDGTGDTEPFKTYISIPPQKYNGLGNLQQFCSQDEIQIFQRQHEWLVGVTKQTSFSNEDLFIVLASADNKVLSVHTFNPPINSLESETPEIVAAPIQESWPKEITTVSFWDKPALEKSPQELITEVSLVAEIFSGSAIFNTFPPSYKMVSHTPSLHVETHQLENLSITEGTPPTSPPLPDSTTQDHMEEPDNKQAKPPYQMTSPMKENTSTSGRPARSPSPSPPVLTPIKPIIPIPQATPTMPILSPFTPRLLPAAVKKHQNGAVWGHSGSLPPTHIQSSTPGPAQNTRDSGRRQIVSPVITILPGTKAGADSAGQNTSHKDISAYSPPPASKKTDRPSDTHVTAPLFSKSKLVTPRPAAKTDTGTFGPLLGHEKPPVTDLTAPVEPGHPSKVSPIIHLKPSNTGDRDPHPISDDEDSKQPPVPDTSRDKAQSRWKTPKQRPQNIFPPPKHEDDVPVTAPQPQGRKILVGGRQLPSLVYNPPTLRDIKTGMSDDKNPEPCVKENPPGVTHDPPLRIQHMEQTVNSSKYNVLLFIEKIIKSVHDHSSYMLSTLKRIKQLYI

Gene
ORF64
Protein
Uncharacterized protein ORF64
Organism
Ictalurid herpesvirus 1 (strain Auburn)
Length
514 amino acids
Mass
58.198 kDa
Sequence
MSSPRGASSMSSRSPVNLEPESDSVDSEWVFGKYRLLGALRSATLEGEDLEGGIPQELLNVLVLYEKMKSTKSELSGFVTYLALMTLGIFDFDRSLKRLVDEGVLGMFRFNRMLTRVFFGYATGDDALIEGLLDTWFAFMVLLARFPVIPAQLIDSNFCVLCMYESDHSLATADTRFKTILCDHFTEASVTAGGDPCDSAEVTAVVKKTTQIDLSLDDFHERVARGDNVRELAVKRDTTLTTRKNGSINNFTKALNRARETCAMDRMESSLVEFQKKLREVNNMINRLTNPKNLNIFAAELFNVFVHAHHRRKTIRERLSDGLGDWKGRAAHMLFLTTKLRTAVDKNLLTTIITEFYAAAVPPVYRYNHKYNMHAHRVIFFKHMESIGFTNEGITAFQYQLNQVDLREVVGQDYRSDIIPITTNAENFNRLTELFWVIANICTFIFIHNKTIKLHHGDAPDLNIDELPDGLYLFNGSVGFKHDNGETRSGVWSSERTLDLLDTYDQLLSTGVIG

Gene
ORF64
Protein
Uncharacterized protein ORF64
Organism
Ostreid herpesvirus 1 (isolate France)
Length
398 amino acids
Mass
46.563 kDa
Sequence
MASINEFIQKYQAIQKDFEEIIENPDWRAECRKKKINVVSKGKKVNFKYDNRCKLKTAWTRSCRGVCVEFDTETGKPIRKPIYSFNKFDNRHNEPDFYNNLLECEAVVLANKFDGSFVRIWYDGVEEKFVTATLGTLSADDKFLVAETMMDQRIARHLKGNPYDCLLAELITPKNIIVTDYNGKSFLTPLSIVSHVDGLPRWSTLRKVVPDMFMENGLPYYCRFTTIETLENDLKEFEQMTIDNPDVYGRIPEGVCVYQCSLKDGLVDVATPMSKIKRDEYVSVHGKPSGKKEEKSKPPAILGRAVTDPKFLQQHAILKFIYDDIEEKTEDEFFMVLENWYENYKTIDRDTNVKKELFGKKDHDKYGRTFRDLLLEIDNKGRTKLEQFFCRYGPQWYQ