About Services Proteins Contact

OPR1

Gene
OPR1
Protein
12-oxophytodienoate reductase 1
Organism
Oryza sativa subsp. japonica
Length
380 amino acids
Function
Probably involved in the biosynthesis or metabolism of oxylipin signaling molecules. In vitro, reduces cis(-)-12-oxophytodienoic acid (cis(-)-OPDA) and to cis(-)-OPC-8:0.
Similarity
Belongs to the NADH:flavin oxidoreductase/NADH oxidase family.
Mass
42.465 kDa
Sequence
MVHAPAKVAAAAAIPLLTPYKMGQLELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATRGGLLIAEATDISPTAQGYPETPGIYTQQQIEAWKPIVDAVHRKGALFFLQIWHVGRVSTTDFQPNGQAPISSTDKQITPDDSGMVYSKPRRLRTDEIPQIIDDFRRAARNAIEAGFDGVEIHGAHGYLLEQFMKDSANDRTDEYGGSLENRCRFAVEVIDAVVAEVGAHRVGIRLSPFVDFMDCFDSDPVALGSYMVQQLNKHPGFLYCHMVEPRMAIIEGRRKIAHGLLPFRKQFNGTFIAAGGYDREEGNKVVADGYADLVAYGRLFLANPDLPRRFELDAPLNRYDRSTFYTQDPVVGYTDYPFLEEIDEESRTTYA

Gene
OPR1
Protein
12-oxophytodienoate reductase 1
Organism
Solanum lycopersicum
Length
376 amino acids
Function
Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds. May be involved in the biosynthesis or metabolism of oxylipin signaling molecules. In vitro, reduces 9R,13R-12-oxophyodienoic acid (9R,13R-OPDA) to 9R,13R-OPC-8:0, but not 9S,13S-OPDA, the natural precursor of jasmonic acid. Also reduces N-ethylmaleimide and maleic acid.
Similarity
Belongs to the NADH:flavin oxidoreductase/NADH oxidase family.
Mass
42.415 kDa
Sequence
MENKVVEEKQVDKIPLMSPCKMGKFELCHRVVLAPLTRQRSYGYIPQPHAILHYSQRSTNGGLLIGEATVISETGIGYKDVPGIWTKEQVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNKDFQPNGEDPISCTDRGLTPQIRSNGIDIAHFTRPRRLTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFALEIVEAVANEIGSDRVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHVVEPRMKTAWEKIECTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDLPKRFELNAPLNKYNRDTFYTSDPIVGYTDYPFLETMT

Gene
OPR1
Protein
12-oxophytodienoate reductase 1
Organism
Arabidopsis thaliana
Length
372 amino acids
Function
Specifically cleaves olefinic bonds in alpha,beta-unsaturated carbonyls and may be involved in detoxification or modification of these reactive compounds (PubMed:9346960, PubMed:10872231). May be involved in the biosynthesis or metabolism of oxylipin signaling molecules (Probable). In vitro, reduces 9R,13R-12-oxophytodienoic acid (9R,13R-OPDA) to 9R,13R-OPC-8:0, but only poorly 9S,13S-OPDA, the natural precursor of jasmonic acid (PubMed:10872231). Can detoxify the explosive 2,4,6-trinitrotoluene (TNT) in vitro and in vivo by catalyzing its nitroreduction to form hydroxylamino-dinitrotoluene (HADNT) (PubMed:19605548).
Similarity
Belongs to the NADH:flavin oxidoreductase/NADH oxidase family.
Mass
41.168 kDa
Sequence
MENGEAKQSVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHAAIYYSQRTTPGGFLITEATGVSDTAQGYQDTPGIWTKEHVEAWKPIVDAVHAKGGIFFCQIWHVGRVSNSGFQPNGKAPISCSDKPLMPQIRSNGIDEALFTPPRRLGIEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPLEIVDAVAKEIGPDRVGIRLSPFADYMESGDTNPGALGLYMAESLNKYGILYCHVIEARMKTMGEVHACPHTLMPMRKAFKGTFISAGGFTREDGNEAVSKGRTDLVAYGRWFLANPDLPKRFQVDAPLNKYDRPTFYTSDPVVGYTDYPFLESTA