About Services Proteins Contact

OLIG1

Gene
OLIG1
Protein
Oligodendrocyte transcription factor 1
Organism
Homo sapiens
Length
271 amino acids
Function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).
Mass
27.905 kDa
Sequence
MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQAQFSK

Gene
Olig1
Protein
Oligodendrocyte transcription factor 1
Organism
Rattus norvegicus
Length
261 amino acids
Function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).
Mass
27.239 kDa
Sequence
MYYAVSQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSTSSSSTASLLPKPAREKPEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFALPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK

Gene
Olig1
Protein
Oligodendrocyte transcription factor 1
Organism
Mus musculus
Length
260 amino acids
Function
Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
Mass
27.141 kDa
Sequence
MYYAISQARVNAAPATMLRPQRPGDVQLGASLYELVGYRQPPISSSSSSSSSTASLLPKPAREKAEAPLAEPRGPAPESGGARADAKEEQQQQQLRRKINSRERKRMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGDGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPETLRPTKYLSLALDEPPCGQFSLPAGGAGSPGLCSCAVCKFPHLVPAGLGLAAVQAQFSK