OEP24

Outer envelope pore protein 24, chloroplastic

224 amino acids

High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.

Belongs to the plastid outer envelope porin OEP24 (TC 1.B.28.1) family.

24.206 kDa

MKATVKGRYEGDKATAAATLAFTPSAADLRFKASATDAAFARGPSLEGLTLTLEKPGSFLLDLKPHSKDVRFQFMNSALLLDRRVSLTYTHSTTLSPGPAKPPARTALDGSLTFDPANKLSLSHTLGSSGCRVKYSYAHGQDRLTTIEPCFDTANNAWDFAVTRKFQGGDAIKATYQASTKLLALDWTRDSKIGASFKVAASFDLSDQSKAPKLIAESTWNYEI

OEP24

Outer envelope pore protein 24, chloroplastic

224 amino acids

High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.

Belongs to the plastid outer envelope porin OEP24 (TC 1.B.28.1) family.

24.234 kDa

MKATVKGRYEGDKATAAATLAFTPSAADLRFKASATDAAFARGPSLEGLILTLEKPGSFLLDLKPHSKDVRFQFMNSALLLDRRVSLTYTHSTTLSPGPAKLPARTALDGSLTFDPANKLSLSHTLGSSGCRVKYSYAHGQDRLTTIEPCFDTANNAWDFAVTRKFQGGDAIKATYQASTKLLALDWTRDSKIGASFKVAASFDLSDQSKAPKLIAESTWNYEI

OEP24

Outer envelope pore protein 24, chloroplastic

213 amino acids

High-conductance voltage-dependent solute channel with a slight selectivity for cations transporting triosephosphates, dicarboxylic acids, ATP, inorganic phosphate (Pi), sugars, and positively or negatively charged amino acids.

Belongs to the plastid outer envelope porin OEP24 (TC 1.B.28) family.

23.382 kDa

MKAALKGKYDLDHNSSGAATVAFNAGDVKLRASITDATFKNSPSLTGLVLAVEKPGSFSVDYNVPKKDFRFQFMNTVRVAEKPLNLAYIHSKGDNRTILDGTLVWDPSNKVSANYAVESGNCKLKYSYNHKGLTTIEPTYDVAKNSWDFAVSGKVYGDDSLKASYQTSSKVLGLEWTRNSKQTGCFKVVASVNLAEEKKIPKLSVESTLNFEM