Nolc1

Nucleolar and coiled-body phosphoprotein 1

704 amino acids

Nucleolar protein that acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification. Required for neural crest specification: following monoubiquitination by the BCR(KBTBD8) complex, associates with TCOF1 and acts as a platform to connect RNA polymerase I with enzymes responsible for ribosomal processing and modification, leading to remodel the translational program of differentiating cells in favor of neural crest specification. Involved in nucleologenesis, possibly by playing a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities.

Belongs to the NOLC1 family.

73.564 kDa

MADTGLRRVVPSDLYPLVLGFLRDNQLSEVASKFAKATGATQQDANASSLLDIYSFWLKSTKAPKVKLQSNGPVAKKAKKETSSSDSSEDSSEEEDKAQVPTQKAAAPAKRASLPQHAGKAAAKASESSSSEESSEEEEEEDKKKKPVQQKAVKPQAKAVRPPPKKAESSESESDSSSEDEAPQTQKPKAAATAAKAPTKAQTKAPAKPGPPAKAQPKAANGKAGSSSSSSSSSSSDDSEEEKKAAAPLKKTAPKKQVVAKAPVKVTAAPTQKSSSSEDSSSEEEEEQKKPMKKKAGPYSSVPPPSVSLSKKSVGAQSPKKAAAQTQPADSSADSSEESDSSSEEEKKTPAKTVVSKTPAKPAPVKKKAESSSDSSDSDSSEDEAPAKPVSATKSPLSKPAVTPKPPAAKAVATPKQPAGSGQKPQSRKADSSSSEEESSSSEEEATKKSVTTPKARVTAKAAPSLPAKQAPRAGGDSSSDSESSSSEEEKKTPPKPPAKKKAAGAAVPKPTPVKKAAAESSSSSSSSEDSSEEEKKKPKSKATPKPQAGKANGVPASQNGKAGKESEEEEEDTEQNKKAAGTKPGSGKKRKHNETADEAATPQSKKVKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSVKFDSE

Nolc1

Nucleolar and coiled-body phosphoprotein 1

702 amino acids

Nucleolar protein that acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification (By similarity). Required for neural crest specification: following monoubiquitination by the BCR(KBTBD8) complex, associates with TCOF1 and acts as a platform to connect RNA polymerase I with enzymes responsible for ribosomal processing and modification, leading to remodel the translational program of differentiating cells in favor of neural crest specification (By similarity). Involved in nucleologenesis, possibly by playing a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus (PubMed:11424213). It has intrinsic GTPase and ATPase activities (By similarity).

Belongs to the NOLC1 family.

73.698 kDa

MADTGLRRVVPSDLYPLVLRFLRDSQLSEVASKFAKATGATQQDANASSLLDIYSFWLNRSTKAPKVKLQSNGPVTKKAKKETSSSDSSEDSSEDEDKKAQGLPTQKAAAQVKRASVPQHAGKAAAKASESSSSEESSEEEEEDKKKKPVQQKAAKPQAKAVRPPAKKAESSESDSDSDSDSSSEEETPQTQKPKAAVAAKAQTKAEAKPGTPAKAQPKVANGKAAASSSSSSSSDDSEEEKKAAAPPKKTVPKKQVVAKAPVKVAAAPTQKSSSSEDSSSEEEEGQRQPMKKKAGPYSSVPPPSVPLPKKSPGTQAPKKAAAQTQPADSSDDSSDDSDSSSEEEKKPPAKTVVSKTPAKAAPVKKKAESSSDSSDSDSSEDEAPAKPVSTTKSPKPAVTPKPSAAKAVTTPKQPAGSNQKPQSRKADSSSSEEESSSSEEEEASKKSATTPKAKVTAKAAPAKQAPQAAGDSSSDSDSSSSEEEEKTPKPPAKKKAAGGAVSTPAPGKKAEAKSSSSSSSSSSEDSSEEEKKKKPKATTPKIQASKANGTPASLNGKAAKESEEEEEEEETEEKKKAAGTKPGSGKKRKQNETADEATTPQAKKVKLETPNTFPKRKKGERRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSVKFDSE

NOLC1

Nucleolar and coiled-body phosphoprotein 1

699 amino acids

Nucleolar protein that acts as a regulator of RNA polymerase I by connecting RNA polymerase I with enzymes responsible for ribosomal processing and modification (PubMed:10567578, PubMed:26399832). Required for neural crest specification: following monoubiquitination by the BCR(KBTBD8) complex, associates with TCOF1 and acts as a platform to connect RNA polymerase I with enzymes responsible for ribosomal processing and modification, leading to remodel the translational program of differentiating cells in favor of neural crest specification (PubMed:26399832). Involved in nucleologenesis, possibly by playing a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus (PubMed:9016786). It has intrinsic GTPase and ATPase activities (PubMed:9016786).

Belongs to the NOLC1 family.

73.603 kDa

MADAGIRRVVPSDLYPLVLGFLRDNQLSEVANKFAKATGATQQDANASSLLDIYSFWLKSAKVPERKLQANGPVAKKAKKKASSSDSEDSSEEEEEVQGPPAKKAAVPAKRVGLPPGKAAAKASESSSSEESSDDDDEEDQKKQPVQKGVKPQAKAAKAPPKKAKSSDSDSDSSSEDEPPKNQKPKITPVTVKAQTKAPPKPARAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPKKTVPKKQVVAKAPVKAATTPTRKSSSSEDSSSDEEEEQKKPMKNKPGPYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDESDSSSEEEKKPPTKAVVSKATTKPPPAKKAAESSSDSSDSDSSEDDEAPSKPAGTTKNSSNKPAVTTKSPAVKPAAAPKQPVGGGQKLLTRKADSSSSEEESSSSEEEKTKKMVATTKPKATAKAALSLPAKQAPQGSRDSSSDSDSSSSEEEEEKTSKSAVKKKPQKVAGGAAPSKPASAKKGKAESSNSSSSDDSSEEEEEKLKGKGSPRPQAPKANGTSALTAQNGKAAKNSEEEEEEKKKAAVVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQVNSIKFDSE