About Services Proteins Contact

Nmul_A1068

Gene
Nmul_A1068
Protein
7-methyl-GTP pyrophosphatase
Organism
Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Length
198 amino acids
Function
Nucleoside triphosphate pyrophosphatase that hydrolyzes 7-methyl-GTP (m(7)GTP). May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.
Similarity
Belongs to the Maf family. YceF subfamily.
Mass
21.678 kDa
Sequence
MKTQQIAQQLILGSSSIYRRDLLQRLQIPFDVSNPDIDETPLPGETPDATAVRLAAAKTRAVAATHPGALIIGADQVAVFEGIQLGKPLNHLNATRQLQLIRGKEVSFYTALCLFNSAQDTTRARLVPSRVKFRLLSDRQIENYLDKEQPYHCAASSKLEGLGIALIEHMEGEDPTALIGLPLIALVEMLTLEGVEIV