About Services Proteins Contact

Nham_0403

Gene
Nham_0403
Protein
Probable intracellular septation protein A
Organism
Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Length
199 amino acids
Function
Involved in cell division; probably involved in intracellular septation.
Similarity
Belongs to the YciB family.
Mass
22.254 kDa
Sequence
MDKKQPHPLFKLATELGPLLVFFAANAKFNLFVATAAFMVAIVAAMIASYVVTRHIPLMALVTGIVVIVFGTLTLVLHDETFIKVKPTIIYSLFAGVLGGGLLFGRSFIAIMFDQVFNLTPRGWQVLTLRWALFFFGMAILNELIWRTQSTDFWVNFKVFGAVPLTMIFAMMQMPLTKRYHLEPATLEASDASEGDVRK