Nep2

Neprilysin-2

774 amino acids

Metalloendoprotease which cleaves peptides such as tachykinin peptide TK-2 at the amino side of hydrophobic residues (PubMed:15554877, PubMed:17157960). Functions in female fertility, embryogenesis and memory formation (PubMed:24395329, PubMed:27629706). Required in females for normal patterns of egg laying, probably due to its function in sperm retention and preventing sperm displacement by rival ejaculates (PubMed:24395329). Also required for normal patterns of hatching due to its important role in early embryonic development (PubMed:24395329). Required in the dorsal paired medial neurons for the proper formation of middle-term memory (PubMed:27629706). Also required in the mushroom body neurons where it functions redundantly with neprilysins Nep3 and Nep4 in normal long-term memory formation (PubMed:27629706).

Belongs to the peptidase M13 family.

88.125 kDa

MQTVIQNPNWWRRRNKLEKSLLVSLGIMFVVLATGFGLWIGKVLRTSPPSNPQATALHGDSTTINQVPTGTASKGKSGDSGDVCLTQECIHTASTVLRKMKPEVEPCDNFYEFACGTYLEEENIPDDKVSISTFSVISDKLQEQLKDIITAERPETEPKHFRLPNLLYKACMNKTLIETLGPEPITRVAERLGGWPLIKGDSWNADDSWTWQEQVKKFRTAGFSMDYIIDFSIGVDLQNSTKRLIDLDQSSLALSREYLVKGFNETLVTAYYKYMVDIAVLFGANRDLAKTELLLSLEFEMALANISWPNEKRRNSSELYNLRTPAQLQAAYPYVQWVDYMNALLPEGLNVAEDEMINLSVPSFFEDLGKLLAKTPKRVIANYMFWRIHGFSVGFLSEEFRKRQLQYATALSGRQEQEARWKECVDIATSSMDEVCEDDFDSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEAKLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPVNKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITHGFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYTERATGLNLNGINTQGENIADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAGQTWCAKYRKESLKMRITTGVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEVW

nep2

Aspartic proteinase nepenthesin-2

438 amino acids

Extracellular proteinase found in the pitcher fluid of carnivorous plants. Digest prey for nitrogen uptake.

Belongs to the peptidase A1 family.

46.174 kDa

MASPLYSVVLGLAIVSAIVAPTSSTSRGTLLHHGQKRPQPGLRVDLEQVDSGKNLTKYELIKRAIKRGERRMRSINAMLQSSSGIETPVYAGDGEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQCFSQPTPIFNPQDSSSFSTLPCESQYCQDLPSETCNNNECQYTYGYGDGSTTQGYMATETFTFETSSVPNIAFGCGEDNQGFGQGNGAGLIGMGWGPLSLPSQLGVGQFSYCMTSYGSSSPSTLALGSAASGVPEGSPSTTLIHSSLNPTYYYITLQGITVGGDNLGIPSSTFQLQDDGTGGMIIDSGTTLTYLPQDAYNAVAQAFTDQINLPTVDESSSGLSTCFQQPSDGSTVQVPEISMQFDGGVLNLGEQNILISPAEGVICLAMGSSSQLGISIFGNIQQQETQVLYDLQNLAVSFVPTQCGAS

nep2

NEDD8-specific protease 2

415 amino acids

Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as the pcu1, pcu2 and pcu4 cullins and other proteins (By similarity). Has a role in meiosis.

Belongs to the peptidase C48 family.

46.433 kDa

MRSNSIFTKEIDSEAVKKSSNLRPPSTGSSNSNGSDTASPKKKKKGFFRSLFGSSSSGSKSCGSPFTRIWLEYFEVSLRKNDVDHFRPGYWILDTNIDFFYEIMLRQVLLKRPKEESQQIYLLRPAMVFFLAQAPNPLEIESALPPAMFDASFIFLPINDTNECGIESGSHWSLLVVSVEKGLGWYYDSMSNGNTNDCNLAIKNLGILLKKEFRVRHMKTPQQINDCDCGLHVCENTRILMYRLLQKPYVPKVDMNLDHSVVDSVRLRKALMEVITSLLAAYGSKVPKPSETHTDPEKDKKIFSKICKTEELLELPTLSAVTSDSAQPHSLPASMPSSQPQSRSESLPLTHPNSEPNPKLDSQPNSSPVRRPSLIKVKTASTSVLPTSILQRPPSIVPRPETAAIQHTQQSIEIH