Function
Bifunctional DNA N-glycosylase with associated apurinic/apyrimidinic (AP) lyase function that catalyzes the first step in base excision repair (BER), the primary repair pathway for the repair of oxidative DNA damage. The DNA N-glycosylase activity releases the damaged DNA base from DNA by cleaving the N-glycosidic bond, leaving an AP site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination. Primarily recognizes and repairs oxidative base damage of pyrimidines. Has also 8-oxo-7,8-dihydroguanine (8-oxoG) DNA glycosylase activity. Also involved in the repair of 7-methylguanine lesions, although it cannot directly repair alkylated DNA bases. Probably does so via excision of methylformamidopyrimidine (mFapy) lesions, a spontaneous processing product of 7-methylguanine.
Sequence
MSKDYGTPPENWREVYDEICKMKAKVVAPVDVQGCHTLGERNDPKKFRFQTLVALMLSSQTKDIVLGPTMRNLKEKLAGGLCLEDIQNIDEVSLNKLIEKVGFHNRKTIYLKQMARILSEKFQGDIPDTVEDLMTLPGVGPKMGYLCMSIAWNKTVGIGVDVHVHRICNLLHWCNTKTEEQTRAALQSWLPKELWFELNHTLVGFGQTICLPRGRRCDMCTLSSKGLCPSAFKEKSGITITKRKVKTIKRVKKRPASESPPLSPLSLPTDDLYYQSIEDKSLIKLEDLDPVDSISHMNEPLKKEPAADIDVDQKPPVAFHSTTKETRSLRRSKRVAKKSSQYFSQQSLQDIEDLV