About Services Proteins Contact

NSUN5P2

Gene
NSUN5P2
Protein
Putative methyltransferase NSUN5C
Organism
Homo sapiens
Length
315 amino acids
Function
May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Similarity
Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family.
Mass
34.347 kDa
Sequence
MPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHLAALLKNQGKIFAFDLDARRLASMATLLAWAGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVQDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAKSCSRCLHTALHIAEAPGSLLPGGKGRCLSSPWKTLGPHRRQQFAF