Function
Transcriptional repressor that binds NRG1 response elements (NRE) of target promoters. Involved in regulation of chlamydospore formation, hyphal growth, virulence, and stress response. Plays a key role in regulating true hyphal growth, but does not regulate pseudohyphal growth in the same fashion. Directs transcriptional repression of a subset of filament-specific genes such as HWP1, HYR1, ALS8, HWP1, or ECE1; via the TUP1 pathway. Functions with UME6 in a negative feedback loop to control the level and duration of filament-specific gene expression in response to inducing conditions. Plays a key role in biofilm formation and dispersion. Plays also the role of a negative regulator of virulence in mice models. Required for the expression of the cell wall genes RBR1.
Sequence
MLYQQSYPITNKLLNASAAGSTSTASIIDGGCTLSKPGSGKTKSTTSLPSFNELLTSIPLPNEFKPSTKNTNQAAAATATSPYNYYMGPPAQHRLPTPPPYPMSSPTTATAATPLSQQSPHLQPQQTLQQPQPYHQQYYNYQYAAPPYPHPSQVPPPASYQQRHQQPMYQNTNGVPIIIRPSPGLITPTSTTFDHAKIRSNSTGDLSANSLALSSNNNTQSKDPRRKHVCKVCSRSFTTSGHLARHNRIHTGERKHQCPWPTCEARFARQDNCNQHYKTHTNGKNKRNRQQHRTLEASHVGTKYNTKSLV