nrg1

Pro-neuregulin-1, membrane-bound isoform

677 amino acids

Direct ligand for the ERBB tyrosine kinase receptors. Induces expression of acetylcholine receptor in synaptic nuclei.

Belongs to the neuregulin family.

75.795 kDa

MAEKKKVKEGKGRKGKGKKDRKGKKAEGSDQGAAASPKLKEIKTQSVQEGKKLVLKCQAVSEQPSLKFRWFKGEKEIGAKNKPDSKPEHIKIRGKKKSSELQISKASSADNGEYKCMVSNQLGNDTVTVNVTIVPKPTYNHLLLMKIYLKVTSVEKSVEPSTLNLLESQKEVIFATTKRGDTTAGPGHLIKCSDKEKTYCVNGGECYVLNGITSSNQFMCKCKPGFTGARCTETDPLRVVRSEKHLGIEFMEAEELYQKRVLTITGICIDLLVVGDMCVVDAYCKTKKQRKKLNDRLRQSLRERNKNITNKDNRPHNPKNPPPRKNVQLVNQYVSKNVISSEHVIERETETSFSTSHYTSTTHHSTTVTQTPSHSWSNGLSESMISEKSYSVIVTSSVENSRHTSPTGPRGRLNGIGGPRDCSYLRHARDTPDSYRDSPHSERYVSAMTTPARMSPVEFKTPISPKSPCLETSPPESSLAVSVPSVAVSPFIEEERPLLLVSPPRLREKRYDRKTPQKTPHKQHNSYHHNPGHDSSSLPPNPLRIVEDEEYETTQEYEPSLEPAKKLVNSRRQKRTKPNGHISNRLELDSDSSSESSTSESETEDERIGEETPFLSIQNPLAASLESASLYRHADSRTNPTSRFSTQEELQARLSSIANQALCDQKKRKMTCKTLFI

Nrg1

Pro-neuregulin-1, membrane-bound isoform

662 amino acids

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Binds to ERBB4 and ERBB3. Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling (By similarity). Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1, and ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons (PubMed:17250808).

Belongs to the neuregulin family.

73.288 kDa

MSERKEGRGKGKGKKKDRGSRGKPGPAEGDPSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPENIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEFITGMPASTETAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLIKCAEKEKTFCVNGGECFTVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYMTSRRKRQETEKPLERKLDHSLVKESKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRQKLHDRLRQSLRSERSNLVNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREVETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESVISESNSVIMMSSVENSRHSSPAGGPRGRLHGLGGPRDNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSVAVSPFVEEERPLLLVTPPRLREKKYDHHPQQLNSFHHNPAHQSTSLPPSPLRIVEDEEYETTQEYESVQEPVKKVTNSRRAKRTKPNGHIANRLEMDSNTSSVSSNSESETEDERVGEDTPFLGIQNPLAASLEVAPAFRLAESRTNPAGRFSTQEELQARLSSVIANQDPIAV

NRG1

Pro-neuregulin-1, membrane-bound isoform

640 amino acids

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4 (PubMed:10867024, PubMed:7902537). Binds to ERBB3 (PubMed:20682778). Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling. Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1 (PubMed:20682778). Ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons (By similarity).

Belongs to the neuregulin family.

70.392 kDa

MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIANGPHHPNPPPENVQLVNQYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLLVTPPRLREKKFDHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKKLANSRRAKRTKPNGHIANRLEVDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLEATPAFRLADSRTNPAGRFSTQEEIQARLSSVIANQDPIAV

NRG1

Pro-neuregulin-1, membrane-bound isoform

602 amino acids

Direct ligand for the ERBB tyrosine kinase receptors. The multiple isoforms perform diverse functions: cysteine-rich domain containing isoforms (isoform 2-isoform 4) probably regulate the expression of nicotinic acetylcholine receptors at developing interneuronal synapses. Isoform Ig-NRG is required for the initial induction and/or maintenance of the mature levels of acetylcholine receptors at neuromuscular synapses (PubMed:8453670, PubMed:9491987). Binds to ERBB3 and integrins to form a complex which is essential for NRG1-ERBB signaling (By similarity).

Belongs to the neuregulin family.

67.454 kDa

MWATSEGPLQYSLAPTQTDVNSSYNTVPPKLKEMKNQEVAVGQKLVLRCETTSEYPALRFKWLKNGKEITKKNRPENVKIPKKQKKYSELHIYRATLADAGEYACRVSSKLGNDSTKASVIITDTNATSTSTTGTSHLTKCDIKQKAFCVNGGECYMVKDLPNPPRYLCRCPNEFTGDRCQNYVMASFYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNVMNMANGPHHPNPPPDNVQLVNQYVSKNIISSERVVERETETSFSTSHYTSTTHHSMTVTQTPSHSWSNGHTESILSESHSVLVSSSVENSRHTSPTGPRGRLNGIGGPREGNSFLRHARETPDSYRDSPHSERYVSAMTTPARMSPVDFHTPTSPKSPPSEMSPPVSSLTISIPSVAVSPFMDEERPLLLVTPPRLREKYDNHLQQFNSFHNNPTHESNSLPPSPLRIVEDEEYETTQEYEPAQEPPKKLTNSRRVKRTKPNGHISSRVEVDSDTSSQSTSSESETEDERIGEDTPFLSIQNPMATSLEPAAAYRLAENRTNPANRFSTPEELQARLSSVIANQDPIAV

NRG1

Transcriptional regulator NRG1

310 amino acids

Transcriptional repressor that binds NRG1 response elements (NRE) of target promoters. Involved in regulation of chlamydospore formation, hyphal growth, virulence, and stress response. Plays a key role in regulating true hyphal growth, but does not regulate pseudohyphal growth in the same fashion. Directs transcriptional repression of a subset of filament-specific genes such as HWP1, HYR1, ALS8, HWP1, or ECE1; via the TUP1 pathway. Functions with UME6 in a negative feedback loop to control the level and duration of filament-specific gene expression in response to inducing conditions. Plays a key role in biofilm formation and dispersion. Plays also the role of a negative regulator of virulence in mice models. Required for the expression of the cell wall genes RBR1.

34.299 kDa

MLYQQSYPITNKLLNASAAGSTSTASIIDGGCTLSKPGSGKTKSTTSLPSFNELLTSIPLPNEFKPSTKNTNQAAAATATSPYNYYMGPPAQHRLPTPPPYPMSSPTTATAATPLSQQSPHLQPQQTLQQPQPYHQQYYNYQYAAPPYPHPSQVPPPASYQQRHQQPMYQNTNGVPIIIRPSPGLITPTSTTFDHAKIRSNSTGDLSANSLALSSNNNTQSKDPRRKHVCKVCSRSFTTSGHLARHNRIHTGERKHQCPWPTCEARFARQDNCNQHYKTHTNGKNKRNRQQHRTLEASHVGTKYNTKSLV

NRG1

Transcriptional regulator NRG1

231 amino acids

Transcriptional repressor involved in regulation of glucose repression. Binds to UAS-1 in the STA1 promoter.

26.743 kDa

MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKHKLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNSDSSEKSSLSQLTCNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKGQ