About Services Proteins Contact

NMCC_0178

Gene
NMCC_0178
Protein
Probable Fe(2+)-trafficking protein
Organism
Neisseria meningitidis serogroup C (strain 053442)
Length
88 amino acids
Function
Could be a mediator in iron transactions between iron acquisition and iron-requiring processes, such as synthesis and/or repair of Fe-S clusters in biosynthetic enzymes.
Similarity
Belongs to the Fe(2+)-trafficking protein family.
Mass
10.18 kDa
Sequence
MARMVFCVKLNKEAEGMKFPPLPNELGKRIFENVSQEAWAAWTRHQTMLINENRLSLADPRAREYLAQQMEQYFFGDGADAVQGYVPQ