About Services Proteins Contact

NMB1133

Gene
NMB1133
Protein
Putative ankyrin repeat protein NMB1133/NMB1171
Organism
Neisseria meningitidis serogroup B (strain MC58)
Length
253 amino acids
Mass
29.197 kDa
Sequence
MMGDSVIYYVEQADEPVNRADERARKTFKYFWRELFWERRRIISALDFAMVKVPFFQDGEDGEICEHMWIDDIYFDGLYIYGVLNNEPGELTNVEQGESVCVPVDDISDWMFVCNGIPYGGFTIQAMRGQMTEEERTEHDAAWGIDFGDPGQILLVYEEKEHPENLEEHPMCRNCIDDFRQQLSQNSDYLREQDEDGYTPLHHEAIAGNALMVQAMLEYGANPASTTSEGYTALDFACLTGWQNVADLLEPRH