NEC1

Highly reducing polyketide synthase NEC1

2758 amino acids

Highly reducing polyketide synthase; part of the gene cluster that mediates the biosynthesis of nectriapyrone and its analogs phomopyrone A, acropyrone and zaepyrone (PubMed:30443971). The nectriapyrone biosynthetic gene cluster consists of two genes, the highly reducing polyketide synthase NEC1 that produces a demethylated analog of nectriapyrone from one unit of acetyl-CoA and one unit of malonyl-CoA; and the O-methyltransferase NEC2 that further methylates the NEC1 product to yield nectriapyrone (PubMed:30443971). Nectriapyrone is further hydrolyzed to nectriapyrone D, also known as gulypyrone B, by an unidentified hydrolase localized outside the nectriapyrone cluster (PubMed:30443971).

298.817 kDa

MFLKQQQQQPVEADFVDCQSTPRAGGPVAGTTFYTVPVRTFGVELGEYWYPGGSRGPVAFVETEKLATFPTRFCASDYAGSSHSSPQPTAVGVSRERLDRGRFLGKHGEMPTLPLDSIASCGVHRIPEYRWIGKWAEQVDDGASAVNIRRLFEASSPIIGLDARFPGDGDTAERFYDFLLAGRSARSEIPPERYNADAFWHPDGNRSGATRARAAHFLKGSISAFDAPLFSITPTEAAAMDPQQRGILESVYRALENGKFPLAVVGGCNLIISPEFALLLDAAGVLGPDGKSYSFDHRGNGYSRGEGFGVVVLKRLPDALRDGDVIRAVIRNSGSNSDGRSPGITQPTKAAQAALIKQVYANAGLDPSVTRFFEAHGTGTAVGDPIEASAIAEVFATHRSHKSPLWVGALKSNIGHLEGAAGVAAVIKGVLTLENGVIPPNTWFERKNPKILDSWNLQFPTEPVVWPQTGLRRMSINSFGVGGSNAHVVMDDALHFLQSYGLVGNHRTVALPRLPGSSSSRRVVSQADSGVEFTDSDSELKTPDGTHSPDSTAEHSKDMNFDSSCTNTDTLQTTDTNKQPKLSAIACPEVLSSSLSRLAVSDEEGRQSQIFVFSSSDKDGVSRVVNELADYLAKKAKQYKPNMRDQSKFLRDLSYTLACKRTRHAWRSFVVAKTQSSLSALLQAKSLATRAASEPQLAFVFTGQGAQWPTMGRGLMAYPTFRESLHEAEEYMTQTLRCPWSLTYELCKEAGASRINDAEFSQPVCTALQVALVDLLRTWKVRPHAVVGHSSGEIAAAYAAGQLSRQSSWRIAYYRGKLATKLIRSLRRRENSQDAHVKKTGMVAVGLDKEQTLAAISRVDSLVGEGSLEIACMNSQESHTVSGDMAKLDALVEVLKSENVFARKLSVGIGYHSRHMLPIADEYVRLIGDIGSDLPPSQGQSLPRYFSSLEGSEITLDRLQSPDYWANNLTSPVRFHEAVELMLRADLGCNSQGESSTVGKKTVTDLLEIGPHAALRGPIRSIVKQVHQTAEWKIGYATVLKRGDGAIENALGAAGSLFCRGFDVDLAAVNQHQVESSRQSIALNGGNNVLMLTDLPGYPFNHKKEYWAESRLSRNYRFRSAPRHELLGAPVPDWDKNDAVWRNYIRITENPWVEHHKVSGEILYPAAGMLVMAIEASRQLVDKDQQVAGFRFKDVSFHLALLIPTNDVGVETRFRLRSVSAGKLAGWSEFQLSTSENDDWKEHCRGFVRTEYSQTGSNTESDSSRLVHSQCEQEIVQAKKSCTSMVHADKVYRKLSNIGLDFGTTFRTLKDVKFDGTSRILARAESQVSHIKKSMPAEYLHSHLVHPSMLDAVLQANLIPIALGSSSRDSLVPVFASDFWVSAATKEGVDFHNSAYLISSHAKLTPGTADAEAALFGIHADTGEPLVTSSGLVFKTIPNTASSGQRNHHRPALNLDWKPDPNYLTEEDALRMFGAPAITQSSDEVSDDIGDCEILCLLYIRRFLASLDDTVVEKLDWHHLRYVSWMRHVVQTTTVKPAVDNISVMEARIAAAGTPEGKLIMAVGRNLANILVTGDVDPLDVIFGDKVAENVYREGLGSRRCYAQMCAYLDALAHVNPSMKILEVGGGTGGATGSIMETLMANGARRFDHYDFTDISPSFFEHAKEAFKQTAEHMSFRVLNIEKEPTDQGYDGQSYNLVLAANVLHATKSMERTLANVRKLLKPGGKLIVFELTNPAVLLGGFCFGVLPGWWLSDEADREWGPLMVVDTWRAYLERAGFSGVDAVFDDFPDAAHQTSSILVSTALPVADASKPVTAVDNLTRYCVLMGERPSVFQRQVADALLPALARTGSVETSTITASAGRDLKGSCCIVLSELDSPTLIDMTTDVFVALQGVLNSCRRIIWLSRSGDDIVAAPDRELVTGLARVVRAEREPPFSFVTVSFAEAERSETIVDKTLQVLDRGQETAENSFRVFNGVVHVPRLVEAGYLTDHISAEANPTSTQATTQEVKLGADPRDFVAQVQSTGLLQGAGTADVCFSEDHSRQQPLADDEVEFKVMACGVGAHDVAAEDSAAGESSLSDMGIQMAGFVTRLGSTAASKFSVGDRVTGISLEGAIKTRARTQAGLLAKISDKLAWNQAAQIPMAYFTACAIIQYMGVGDSDDILLVHRAAASAAGLAAVQVARSNGAKIFATVANAQERTALQGVGGLLTDQILDLDQNTTLSTIVKSKTGNRGVSMIIDSLPQSDVDHAASLVDCLAPFGRFVSLGDGPMPGISSRRNICLERFNGAELMALDYEKAQRIFLRAARFILDEPLAANAQVPVYKFSEVSEAFAQLGKGEDAVVLEPHDEDVVKVVTSQQSHTDFTSRFDPGASYMVVGGLGGLGRSVSRWMASKGAKSLVLVSRKGAVTPEAQVLVAELQDLGVKVTTPACDATDKMALRRALDQCVAHMPPIKGVIQCSMVLKDKRFFEMSLEEWNTAIRPKVDVSVNLHDALDTASLDFFIMLSSTVGLTGSVEQANYAAGGTFQDAFARSLAASQTASSGPVAVSLDLPVILDVGFVAEKPELMDQLRAAGWAYMEEEEFHAALGYHCFQRRQLDLPTSVLRAQVAPRLWLAQDTADEGTEPPAWVRDPLFSHLRPQSSETTGNGAAGGEAGKKEMKHTALLAAATSAAEAQAVVLDALLAKLSRVLSVELSDLDPACPLSRYGVDSLVAVSLRAWIGKELGAELSVFEMTDKPSIRALAAAVAGRSRLVSKALS

NEC1

Nuclear egress protein 1

376 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

42.313 kDa

MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAEDGRLHMHVIFENPDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP

NEC1

Nuclear egress protein 1

376 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

42.302 kDa

MSSVSGVRTPRERRSALRSLLRKRRQRELASKVASTVNGATSANNHGEPPSPADARPRLTLHDLHDIFREHPELELKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIACTSCEDNRILPTASDAMVAFINQTSNIMKNRNFYYGFCKSSELLKLSTNQPPIFQIYYLLHAANHDIVPFMHAENGRLHMHVIFENSDVHIPCDCITQMLTAAREDYSVTLNIVRDHVVISVLCHAVSASSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQSSGNNLYEEATSSYAIRSPLTASPLHVVSTNGCGPSSSSQSTPPHLHPPSQATQPHHYSHHQSQSQQHHHRPQSPPPPLFLNSIRAP

NEC1

Nuclear egress protein 1

345 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

38.521 kDa

MSDVALKRNSSFFRAKARLTLLKRRDGGVISRSLEHRRSSRRRSSVSAPTRRVSGTLAKLGADDRRQFFDAFFRMTAVSPEETVSLLRSMTVPVIQQENISLPYDINAKFAPGDCISLSEMGYTLEMGGCCSLCSYGWSTTTPPELPALELAFMHHLSSVVEFKELVTSLRVCAGNSIVGNGAYENEGLLRMIKHLLEQSTLFYAYYTVKGGVSHDFRVLISEDGGGDGGSPAYAMYFVFKPGSPLHLGAKLIRQLIFNCPGYKWHADVHEGAFLLVVTRDRCSAIPEPRRVKLDPEDVYRRYCDVLVTEEKVHDYSRLYSTFSTYCPPASRREQTAAPATAKQV

NEC1

Nuclear egress protein 1

333 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

38.236 kDa

MHLKPTRFFHANQPPMPHSYEMEDLCFDDMQYRWSPSNTPYRSMSRRYKSVSRSGPSMRVRSRTPCRRQTIRGKLMSKERSVYRHYFNYIARSPPEELATVRGLIVPIIKTTPVTLPFNLGQTVADNCLSLSGMGYHLGLGGYCPTCTASGEPRLCRTDRAALILAYVQQLNNIYEYRVFLASILALSDRANMQAASAEPLLSSVLAQPELFFMYHIMREGGMRDIRVLFYRDGDAGGFMMYVIFPGKSVHLHYRLIDHIQAACRGYKIVAHVWQTTFLLSVCRNPEQQTETVVPSIGTSDVYCKMCDLNFDGELLLEYKRLYALFDDFVPPR

NEC1

Nuclear egress protein 1

326 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

36.526 kDa

MFDGRSDIYDSTSFAAELDDLYSCRSTGRENGRRSRVSTRGVHRDRCGSAAKRRSTKRRCELVARERDRYSLYLDYMASHPSDEISAVRELVVPLIKTTSITLPFDLNQTVADNCLSLSGMGYYLGIGGCCPTCTVSGEPRLHRADRAALILAYVQQLNNIYEYRGFLASVLAAAAQGDQAGVAASEGVQAERLLENVLAQPELFFAYHVLRDGGIQNVRVLFYRDLSVSGYMMYAVFPTKSVHLHYRLIDRLLAACPGYKIIAHVWQTAFVLVVRRDEGQQTDMDIPTVSAGDIYCKMCDLSFDGELLLEYKKLYAVFDDFLPPV

NEC1

Nuclear egress protein 1

318 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

35.361 kDa

MAPVTPDAVNARQQRPADPALRRLMHPHHRNYTASKASAHSVKSVSRCGKSRSELGRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQVHVPQEFSSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPIFSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDTVYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILENKQ

NEC1

Nuclear egress protein 1

318 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

35.361 kDa

MAPVTPDAVNARQQRPADPALRRLMHPHHRNYTASKASAHSVKSVSRCGKSRSELGRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFLREMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQVHVPQEFSSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPIFSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDTVYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILENKQ

NEC1

Nuclear egress protein 1

306 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

33.953 kDa

MYDTDPHRRGSRPGPYHGKERRRSRSSAAGGTLGVVRRASRKSLPPHARKQELCLHERQRYRGLFAALAQTPSEEIAIVRSLSVPLVKTTPVSLPFCLDQTVADNCLTLSGMGYYLGIGGCCPACNAGDGRFAATSREALILAFVQQINTIFEHRAFLASLVVLADRHNAPLQDLLAGILGQPELFFVHTILRGGGACDPRLLFYPDPTYGGHMLYVIFPGTSAHLHYRLIDRMLTACPGYRFVAHVWQSTFVLVVRRNAEKPTDAEIPTVSAADIYCKMRDISFDGGLMLEYQRLYATFDEFPPP

NEC1

Nuclear egress protein 1

305 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

34.322 kDa

MDRERPRKTREPASPGSVLSKRSKLSRKSLALRSLNKFHPYKAPSSVRSLKKAHTLVSNGDFFNGISLNCEFGKDFLREMDTPICTSKVICLPLDVHEIAPGRCLVLSPLGHACNMGFYCEKCTQSGQNSYSQFQGRGGNAKMAAQNSKDDLHSVTLTFYNQVSKVVQNKNFYLSLLSHSLTTIKKSFVQPSLLYSYTVLRALCDDVFPIFKDTENGLCMFALFKTDDLHVSETCLRHLVDNLIHYRVTLDCVKHTYMLKFSPIRAEANGMTIQEVEICEAITGLDFTDEIKQEIISGQELVSEL

NEC1

Nuclear egress protein 1

305 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

33.915 kDa

MYDIAPRRSGSRPGPGRDKTRRRSRFSAAGNPGVERRASRKSLPSHARRLELCLHERRRYRGFFAALAQTPSEEIAIVRSLSVPLVKTTPVSLPFSLDQTVADNCLTLSGMGYYLGIGGCCPACSAGDGRLATVSREALILAFVQQINTIFEHRTFLASLVVLADRHSTPLQDLLADTLGQPELFFVHTILRGGGACDPRFLFYPDPTYGGHMLYVIFPGTSAHLHYRLIDRMLTACPGYRFAAHVWQSTFVLVVRRNAEKPADAEIPTVSAADIYCKMRDISFDGGLMLEYQRLYATFDEFPPP

NEC1

Nuclear egress protein 1

302 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

33.158 kDa

MPKSVSSHISLATSTGRSGPRDIRRCLSSRLRSVPPGARSASVSSKHRNGLRKFISDKVFFSILSHRHELGVDFLREMETPICTSKTVMLPLDLSTVAPGRCVSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVGDALKKNNELCSVALAFYHHADKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTTNNGMLTMCILFKTRALHLGETALRLLMDNLPNYKISADCCRQSYVVKFVPTHPDTASIAVQVHTICEAVAALDCTDEMRDDIQKGTALVNAL

NEC1

Nuclear egress protein 1

300 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

34.249 kDa

MTGHTLVRRKSIGRDKRLVGRSRRQWRDMNLPSYGNSKGTNMDIYRAYFEFIAESPADELMLVKDLVTPLIKTTSISLPFDMSEAVADNCLSLSGMGYYLGVGGCCPTCVSSGDPRLGRNDRAALILAYVQQINNIYHYRIFLASIIVLGDRLRGDARDKDMESILTRIIAIPELFFAYYVLLDSGIKNVKVLFYLDREAGSSEYMMYIVFPGKALHLHYRLIDCMKSACKSYRIIAHVWRTNFLLVIRKEYDRQTDSCDVPAVNAEDVYCKLCDLNIDGELLLEYGKLYSAFDEFLPPR

NEC1

Nuclear egress protein 1

280 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

31.415 kDa

MHKIQKMSCTPSVRSRYTLKRKRLNSAKSATLKKKKVFLSNSEFFAGVSTNYELGKDFLREMDTPICTSNTVFLPVKFSDVAPGRCLTLSPYGHSSVLGFHCQECKPDSSSGFTQAQQSAESNELLSVNLCFLNNVEKVVQHKAFYLSLLGHSMNTVKQSLGQPSLLYCYTVLKKFYPQIFPIFTANGPMLTMYIIFTSLTLHVSEAVLRILTDNVENHNLSADCYKGHYILSIEPQALEESNLNVCVTKICDLVAQLDFSDELKQEYVNGSTLIANFLN

NEC1

Bidirectional sugar transporter NEC1

265 amino acids

Mediates both low-affinity uptake and efflux of sugar across the plasma membrane. Promotes the formation of phloem bundles in mid-veins. Probably involved in the development of stomium cells that control anther opening time. Required for pollen viability (PubMed:11135107, PubMed:11405624).

Belongs to the SWEET sugar transporter family.

30.256 kDa

MAQLRADDLSFIFGLLGNIVSFMVFLAPVPTFYKIYKRKSSEGYQAIPYMVALFSAGLLLYYAYLRKNAYLIVSINGFGCAIELTYISLFLFYAPRKSKIFTGWLMLLELGALGMVMPITYLLAEGSHRVMIVGWICAAINVAVFAAPLSIMRQVIKTKSVEFMPFTLSLFLTLCATMWFFYGFFKKDFYIAFPNILGFLFGIVQMLLYFVYKDSKRIDDEKSDPVREATKSKEGVEIIINIEDDNSDNALQSMEKDFSRLRTSK

NEC1

Nuclear egress protein 1

264 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

30.845 kDa

MTVHKSRIRRSRSLSVTHRIQKRPDHREKTKLYLQLKLHDLHTVFNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHCESVSVPTSSDAMVAHLNQVNNVMQNRLYFYGFRKDMELIRMSAKQPTIFQIFYIVHNTINNIFPIMFERKQKLGMHIVFQSRTLHIPCECIKQIVAVSSGYNVYLDILQESVILTVLCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGFH

NEC1

Nuclear egress protein 1

264 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

30.869 kDa

MTVHKNRFRRSRSLSVTHRIQKRPDHREKTKLYLQLKLHDLHAVFNLFPEYEQKFLAIIKLPITGKEPIDVPFSLSNHHQHTCLEFSPYANEQISKSACLHCESVSVPTSSDAMVAHLNQVTNVMQNRFYFYGFRKDMELIRMSAKQPTIFQIFYIVHNTINNIFPIMFEKKQKLGMHIVFQSRTLHIPCECIKQIIAVSSGYNVYLDILQDSVILTVLCETLDTNTNIHIDIGMLQKKLEEMDIPNEISDRLEKYKGHLIGFH

NEC1

Nuclear egress protein 1

261 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

29.784 kDa

MSSRSVKSRKSTKSRRHHPYVKLTDKMFFSAISSKKELGTDFLREMDAPICTSKTILLPLDLNSISPGRCIYLSPFGHSSNMEFQCEKCTESKNKGSGDVSQNHDLYSVTLVFYKNVDKVVKHKAFYLSLLSHSMENLKKSFTQPELLYAYVVVKEAGHNVFPIFFEKDDCLSICLTFKCQTLHIGESCLRMLMDNLPNYKISIDYIKDVYAMTFTQCFAIQRNISIAEDTICESVSTLDCTDELREEIVKGINALQIKDI

NEC1

Nuclear egress protein 1

259 amino acids

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Belongs to the herpesviridae NEC1 protein family.

29.885 kDa

MAIQSTRRLRRASSLLKKSKPYNKEKTNLSLSLSLKELHSVFKLFPEYELKFLNMMKLPITGKEPIKIPFDLSLHHQHTCLDLSPYANEQVSKSACVNCGTTNIPTASDAMVAYMNQISNVMQNRLYYYGFQKKVELIRMSAKQPTLFQIFYILSSIASNFLPIMFENNEKLNMYVVFQTRTLHIPCECINQIMTVSSGYTVLLDILHDSIVLHVLCKTIETSNIQIDINVLQRKIEEMDVPDEIGDKFEKLKHILPFI

NEC1

Nectarin-1

229 amino acids

May interact with bacterial adhesins thereby protecting the reproductive tissues from microbial attack. Has no oxalate oxidase activity (By similarity).

Belongs to the germin family.

24.765 kDa

MAAFGIKSKIFQIMEMTILFLFAISIDRYCFAADEDMLQDVCVADLHSKVKVNGFPCKTNFTAADFSSFAISKPGATNNKFGSKVTTANVEQVPGLNTLGVSLARIDYAPGGINPPHTHPRASEMVFVMEGELDVGFITTANVLVSKQITKGEVFVFPRGLVHFQKNNGKIPAAVVSAFNSQLPGTQSIPITLFGASPTVPDDVLAQTFQINIEDVQQIKSKFAPAKKF