About Services Proteins Contact

NE0277

Gene
NE0277
Protein
dITP/XTP pyrophosphatase
Organism
Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Length
203 amino acids
Function
Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions.
Similarity
Belongs to the HAM1 NTPase family.
Mass
22.034 kDa
Sequence
MNKIVIASNNAGKLAEISRLLAPLGIEVVTQSSLGVTEADEPHMTFVENALAKARHASLATGLPALADDSGICVSALRGDPGVFSARYAGEPRSDERNNRKLVEALHGQSDRRAYYYCVIVLLRHGQDPQPVIIEDTWRGEIIAEPIGQGGFGYDPHFFLPELGKTAAELSIEEKNRISHRGKALARLVQMLSENETVPVVPV