NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.524 kDa

MSGYTPEEKLRLQQLRELRRRWLKDQELSPREPVLPPQRVSPVERFWNKFLQDGALWKNVIYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPMKEFPDQHH

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.489 kDa

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.489 kDa

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

Ndufb6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.515 kDa

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRMWPLERFWDNFLRDGAVWKNMVFKAYRSSLFAVSHVLIPMWFVHYYVKYHMATKPYTIVSSKPRIFPGDTILETGEVIPPMRDFPDQHH

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.489 kDa

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.39 kDa

MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPLLPPRRVWPMEQFWNKFLQDGAPWKNVIYKTYRHSIFAVTHVLIPVWIIHYYLKYHVTAKPYTVVERKPRIFPGDTILXTGEVIPLIEGFPXQPS

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.551 kDa

MTEYTPDEKLRLHQLRKLRRRWLKDQELSHREPVLPPQKMGPMEKFWNTFLENKSPWRKMVHGVYQKSIFVFTHILVPAWIIHYYMKYHVSEKPYGIVETKPRIFPGDTILETGEVIPPMKEFPDQHH

NDUFB6

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6

128 amino acids

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Belongs to the complex I NDUFB6 subunit family.

15.489 kDa

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYQKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH