Function
Involved in a signaling pathway that modulates root auxin transport and auxin gradients. Acts partially by positively regulating the auxin carrier PIN2 and AUX1 (PubMed:19948787). Acts, together with GB1 as positive regulator of meristem initiation and branching. GB1 and NDL3 positively regulate basipetal inflorescence auxin transport and modulate MAX2 expression in shoots, which regulates organ and lateral meristem formation by the establishment and maintenance of auxin gradients (PubMed:24223735).
Sequence
MVGLNNAVSLDIEEICNGGKEHHVKTCHGSVSVVVYGDQEKPALITYPDVALNYMSCFQGLFLCPEAVSLLLHNFCIYHISPPGHEFGAAPVCSNDPSPSVEDLADQILEVLNFFSLEAVMCMGITAGAYILSLFAIKHKERVLGLILISPLCKAPSWSEWFYYKVVSNLLYYYGMSGLLKDIFLQRYFSKEARGSSEVPERDVVHECRRLLGERHGSSLMRFLEAVNRRHDLTDGLKSLKCRTLIFVGDQSPFHSETLHMVTALDRKYSALVEVQACGSMVTEEQPHAMLIPMEFFFMGFGLYRPGRVSDSPRSPLSPSCISPELLSPESLGLKLKPIKTRVPTKC