About Services Proteins Contact

NAP1;1

Gene
NAP1;1
Protein
Nucleosome assembly protein 1;1
Organism
Oryza sativa subsp. japonica
Length
378 amino acids
Function
May modulate chromatin structure by regulation of nucleosome assembly/disassembly.
Similarity
Belongs to the nucleosome assembly protein (NAP) family.
Mass
42.638 kDa
Sequence
MGGDKENLDLSDLNASLPAAAAALSAEDRAGLVNALKDKLQSLAGQHTDVLEALSPNVRKRVEYLREIQGQHDEIELKFFEERAALEAKYQKLYEPLYTKRYNIVNGVVEVDGGNDEPASENAAEGKDADAKGVPDFWLTAMKTNEVLSEEIQERDEPALKYLKDIKWARIDDPKGFKLDFFFDTNPFFKNSVLTKTYHMVDEDEPILEKAIGTEIEWYPGKNLTQKILKKKPKKGSKNAKPITKTEVCESFFNFFSPPQVPDDDEDIDEDTADELQGQMEHDYDIGTTIRDKIIPHAVSWFTGEAVQAEDFDDMEDDEEDDEDDDEDEEEEEEDEDEDEDDEEEKSKPKKKSAGKPKLPSKGGAQGGADQPADCKQQ

Gene
NAP1;1
Protein
Nucleosome assembly protein 1;1
Organism
Oryza sativa subsp. indica
Length
377 amino acids
Function
May modulate chromatin structure by regulation of nucleosome assembly/disassembly.
Similarity
Belongs to the nucleosome assembly protein (NAP) family.
Mass
42.599 kDa
Sequence
MGGDKENLDLSDLNASLPAAAAALSAEDRAGLVNALKDKLQSLAGQHTDVLEALSPNVRKRVEYLREIQGQHDEIELKFFEERAALEAKYQKLYEPLYTKRYNIVNGVVEVDGGNDEPASENAAEFKDADAKGVPDFWLTAMKTNEVLSEEIQERDEPALKYLKDIKWARIDDPKGFKLDFFFDTNPFFKNSVLTKTYHMVDEDEPILEKAIGTEIEWYPGKNLTQKILKKKPKKGSKNAKPITKTEVCESFFNFFSPPQVPDDDEDIDEDTADELQGQMEHDYDIGTTIRDKIIPHAVSWFTGEAVQAEDFDDMEDDEEDDEDDDEDEEEEEDEDEDEDDEEEKSKPKKKSAGKPKLPSKGGAQGGADQPADCKQQ

Gene
NAP1;1
Protein
Nucleosome assembly protein 1;1
Organism
Nicotiana tabacum
Length
374 amino acids
Function
May modulate chromatin structure by regulation of nucleosome assembly/disassembly. Could function together with B-type cyclins in the regulation of microtubule dynamics.
Similarity
Belongs to the nucleosome assembly protein (NAP) family.
Mass
42.579 kDa
Sequence
MSNTKDNFNVADLTAALGAGDREDLVNALKNKLQDITGKPTNVLECLSPNVRKRVEVLKEIQSQHDELEAKFYEERAVLEAKYQKLYQPLYTKRFDIVNGVVEVNTSETEAAAMDQDEDEDAVGKGVPDFWLIAMKNNDVLSEEITERDEGALKFLKDIKWAKIDNPKGFKLEFFFDTNPYFTNTVLTKTYHMIDEDEPILEKALGTEIEWYPGKCLTQKILKKKPKKGSKNAKPITKTEQCESFFNFFSPPQVPEDEEDIDEDAAEELQSLMEQDYDIGSTIRDKIISHAVSWFTGEAAEDDFADLEDDDDDDEEDDDDEDEEEEDDEDDEDEEDEDDTNTKKKSSAVRKRGVRAHAPAGGQAGERPPECKQQ

Gene
NAP1;1
Protein
Nucleosome assembly protein 1;1
Organism
Arabidopsis thaliana
Length
372 amino acids
Function
May modulate chromatin structure by regulation of nucleosome assembly/disassembly (By similarity). Contributes to the regulation of cell proliferation and cell expansion. May function in nucleotide excision repair (NER). Involved in somatic homologous recombination.
Similarity
Belongs to the nucleosome assembly protein (NAP) family.
Mass
42.997 kDa
Sequence
MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ