About Services Proteins Contact

Msp_1167

Gene
Msp_1167
Protein
tRNA (cytidine(56)-2'-O)-methyltransferase
Organism
Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Length
175 amino acids
Function
Specifically catalyzes the AdoMet-dependent 2'-O-ribose methylation of cytidine at position 56 in tRNAs.
Similarity
Belongs to the aTrm56 family.
Mass
19.945 kDa
Sequence
MITVLRLDHRLGRDTRITTHVCLTARAFGADKVILSGEHDKHIIESAQKVVENWGGDFEVEYQKAYRPVIKEHKQKGFEIIHLTMYGKHVEDVVPTIRDNNRDKLIIVGGSRVPTDVYEAADWNLSVTNQPHSEVAALAICLHYMMDGSELKTVYDDGKMQIVPNNEHKEVIKNE