About Services Proteins Contact

Mevan_1275

Gene
Mevan_1275
Protein
Uncharacterized protein Mevan_1275
Organism
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Length
205 amino acids
Mass
23.771 kDa
Sequence
MKKIISIKGTEKEVIEICERISKMGIDYSFDAKANYSENKAYNSARIKIFGEDKNKLVEDYKNILSIIEHVHNKYNVDVKGLYEYKLSDLKYPVNKDLVLDTLSALKINFKYLKDENVIKCELKVEELNDILKNILEIYSELNVYKLGSKPVKNVLALASYITGNDVNILLEKGLEKELFREENEKIVLNKDIDLTRKELLSVKK