MYF5

Myogenic factor 5

258 amino acids

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein (By similarity).

28.457 kDa

MEVMDSCQFSPSELFYDSSCLSSPEGEFPEDFEPRELPPFGAPAPTEPACPEEEEHVRAPSGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTANPNQRLPKVEILRNAIRYIESLQELLREQVENYYHLPGQSCSEPTSPSSSCSDVMADSRSPVWPARGSSFEAGYCREMPHGYATEQSGALSSLDCLSSIVDRLSPAEEPGLPLRHAGSLSPGASIDSGPGTPGSPPPRRTYQAL

MYF5

Myogenic factor 5

255 amino acids

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein (By similarity).

28.242 kDa

MDMMDGCQFSPSEYFYDGSCIPSPDGEFGDEFEPRVAAFGAHKADLQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFDTLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSSCSDGMPECNSPIWSRKSSSFDSVYCPDVPNVYATDKSSLSSLDCLSSIVDRITNSEQPGLPLQDPASLSPVASTDSQPATPGASSSRLIYHVL

MYF5

Myogenic factor 5

255 amino acids

Transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation (PubMed:29887215). Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.

28.296 kDa

MDVMDGCQFSPSEYFYDGSCIPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKSSTFDSIYCPDVSNVYATDKNSLSSLDCLSNIVDRITSSEQPGLPLQDLASLSPVASTDSQPATPGASSSRLIYHVL

Myf5

Myogenic factor 5

255 amino acids

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYOG and MYOD1, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.

28.229 kDa

MDMTDGCQFSPSEYFYEGSCIPSPEDEFGDQFEPRVAAFGAHKAELQGSDDEEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKNSSFDSIYCPDVSNACAADKSSVSSLDCLSSIVDRITSTEPSELALQDTASLSPATSANSQPATPGPSSSRLIYHVL

myf5

Myogenic factor 5

255 amino acids

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein (By similarity).

28.643 kDa

MEMVDSCHFSPSEFFYDSSCIPSPEEGYTEDYEHGMSIYGAHKKDLEESDEDEHVRAPIGHHQAGNCLMWACKACKRKSSTTDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPKVEILRNAIQYIESLQDLLREQVENYYSLPGQSCTEPGSPMSSCSDGMSDCSSPQWSGRNSSFDNVYCSDLQTSFSSTKLTLSSLDCLSSIVDRISSPQQCSLPIPDSITPSPTSSTDSLPRSPDAHDCRPIYHVL

MYF5

Myogenic factor 5

246 amino acids

Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein (By similarity).

26.999 kDa

single

RVRARIPGLSSPEGEFPEDFEPRELPPFGAPAPTEPACPEEEEHIRAPSGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTANPNQRLPKVEILRNAIRYIESLQELLREQVENYYHLPGQSCSEPTSPSSSCSDAMGRTAAGPVWPARGSSFEAGYCPEMPHAYATEQSGALSSLDCLSRIVDRLSPAEEPGLPLRHAGSLSPGASIDSGARTPGSPPPRTYQAL