Function
Participates in the regulation of gene transcription (PubMed:8929412, PubMed:16087886, PubMed:24173801, PubMed:24615015, PubMed:25999153, PubMed:25858587). Binds DNA in a non-specific manner, yet also specifically recognizes the core sequence CAC[GA]TG (PubMed:8929412). Seems to activate the transcription of growth-related genes; required for cellular proliferation and growth (PubMed:16087886, PubMed:25999153, PubMed:25858587). Functions in the TORC2-mediated regulation of cell growth, acting downstream of the TORC2 complex (PubMed:25999153). Inhibits the demethylase activity of Lid (PubMed:17311883). Activates transcription of mbm (PubMed:24615015). Has a role in ribosome biogenesis and endoreplication in fat body cells by activating the transcription of LTV1 (PubMed:25858587). Able to induce the SCF E3 ubiquitin-protein ligase member archipelago (ago) which functions in its degradation (PubMed:15182669, PubMed:24173801). It may therefore create a negative feedback loop with ago that is regulated by the ubiquitin hydrolase puf (PubMed:24173801).
Sequence
MALYRSDPYSIMDDQLFSNISIFDMDNDLYDMDKLLSSSTIQSDLEKIEDMESVFQDYDLEEDMKPEIRNIDCMWPAMSSCLTSGNGNGIESGNSAASSYSETGAVSLAMVSGSTNLYSAYQRSQTTDNTQSNQQHVVNSAENMPVIIKKELADLDYTVCQKRLRLSGGDKKSQIQDEVHLIPPGGSLLRKRNNQDIIRKSGELSGSDSIKYQRPDTPHSLTDEVAASEFRHNVDLRACVMGSNNISLTGNDSDVNYIKQISRELQNTGKDPLPVRYIPPINDVLDVLNQHSNSTGGQQQLNQQQLDEQQQAIDIATGRNTVDSPPTTGSDSDSDDGEPLNFDLRHHRTSKSGSNASITTNNNNSNNKNNKLKNNSNGMLHMMHITDHSYTRCNDMVDDGPNLETPSDSDEEIDVVSYTDKKLPTNPSCHLMGALQFQMAHKISIDHMKQKPRYNNFNLPYTPASSSPVKSVANSRYPSPSSTPYQNCSSASPSYSPLSVDSSNVSSSSSSSSSQSSFTTSSSNKGRKRSSLKDPGLLISSSSVYLPGVNNKVTHSSMMSKKSRGKKVVGTSSGNTSPISSGQDVDAMDRNWQRRSGGIATSTSSNSSVHRKDFVLGFDEADTIEKRNQHNDMERQRRIGLKNLFEALKKQIPTIRDKERAPKVNILREAAKLCIQLTQEEKELSMQRQLLSLQLKQRQDTLASYQMELNESRSVSG