mta-1

Mating-type protein a-1

382 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional activator that induces the transcription of a-specific genes like mating factor mfa-1. Required for mating as an a-cell, blocking of heterokaryon formation (vegetative incompatibility) and for perithecium induction.

43.467 kDa

MDGNSTHPAPNLKTTMAWSRISNQLGHWNDRKVIAIPLSDFLNTHPDIQSGIIAEFKKATGEEGMFARDPESLGIMLLGPVKLFKPDSVVVDGNLFWDPKGIHASAPKEQQKKAKIPRPPNAYILYRKDHHREIREQNPGLHNNEISVIVGNMWRDEQPHIREKYFNMSNEIKTRLLLENPDYRYNPRRSQDIRRRVSPYLKIKLLNYDVNGNLLWGTVNAEDAALIRTHFHGVVRVEEMDDGCRIVCRPVAGSRKLRAAVVDTWMPRYTVDTTPVTEDDDAQAFNFNDPLGGAYFPLNEHLWITVNQNPPFNAPPPNPNPHLDFVHPDGMEAVVHNVQNMIAQVQEANEAAALTLPPPPPLRLLSLRLWLMIPLTQLSFPL

mtA-1

Mating-type protein A-1

293 amino acids

Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional activator that induces the transcription of A-specific genes like mating factor ccg-4. Required for mating as an A-cell and for blocking of heterokaryon formation (vegetative incompatibility).

Belongs to the MATALPHA1 family.

33.179 kDa

MSGVDQIVKTFADLAEDDREAAMRAFSRMMRRGTEPVRRIPAAKKKVNGFMGFRSYYSPLFSQLPQKERSPFMTILWQHDPFHNEWDFMCSVYSSIRTYLEQEKVTLQLWIHYAVGHLGVIIRDNYMASFGWNLVRFPNGTHDLERTALPLVQHNLQPMNGLCLLTKCLESGLPLANPHSVIAKLSDPSYDMIWFNKRPHRQQGHAVQTDESEVGVSAMFPRNHTVAAEVDGIINLPLSHWIQQGEFGTESGYSAQFETLLDSILENGHASSNDPYNMALAIDVPMMGFNGGA

MTA-1

Mating type protein A-1

286 amino acids

Required for expression of the heterokaryon incompatibility and sexual functions.

Belongs to the MATALPHA1 family.

32.431 kDa

MSCVDQIVKTFADLTEGDREAAMRAFSMMMRTEPVRQTPAAKKKVNGFMSFRSYYSPLFSQLPQKERSPFMTILWQHDPFHNEWNFMCSVYSSIRTYLEQEKVTLQLWIHYRVRHLGVIIRDNYMASFGWNLVQLPNGTHDLERTALPLVQHNLQPMNGLCLFTKCLESGLPLANPHPVIAKLSDPSYDMIWFNKRPHRQQGHAGQTYNSELGVSALFPCNHAVAAAVDGITDLPLSHWLQQGDFGTEAGFSPQFETLLDSILENGNASINDPYNMALGMGVPMMG