MT-ATP6

ATP synthase subunit a

237 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

26.158 kDa

MTLDIFDQFTSPTMFGLPLAWLAMLAPSLMLVSQTPKFIKSRYHTLLTPILTSIAKQLFLPMNQQGHKWALICMASMMFILMINLLGLLPYTYTPTTQLSMNMGLAVPLWLATVLIGLQKKPTEALAHLLPEGTPAALIPMLIIIETISLFIRPIALGVRLTANLTAGHLLMQLVSMTTFVMIPVISISIITSLLLLLLTILELAVAVIQAYVFILLLTLYLQENVYVPPSSCMPHG

MT-ATP6

ATP synthase subunit a

228 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

25.341 kDa

MMMSLFNTFESPYFLGFPLMIFIAILISLTMFIPDNNLLIKNQSSMLASTFLKTMTKEIFSPIKKSGHSWALLLMTTLMFIFLNNITGLLPYTFTVTSQLSLNMAMAIPLWLGTIIMGATSQPSHSLAHLLPEGTPMTLAPFLIVIESISIIIRPLALGVRLTANITAGHLLIHLVSLALINLTKSLPLLFLTFSVFILLLILELAVSFIQAYVFVMLVSLYLEENLI

MT-ATP6

ATP synthase subunit a

228 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.25 kDa

MNLTLFDQFSSPNILAIPLMTISLLMLTIIFPMKHNRLLTNRLLSIQSKMIHIFTKQLMLPIPKSGHHWALILTSLMTLLLTSNLLGLLPYTFTPTTQLSMNLGFALPMWLATLLIGLRNQPTMSLAHLLPEGTPTPLIPTLILIESISLMIRPLALGVRISANLTAGHLLMQLTSSATLSLSSMPTLSFMTAILLFLLTILEMAVAMIQALVFVLLLSLYLQENTHN

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.997 kDa

MNLSFFDQFSSPHLLGHPLILLSLLLPALLFPSPGNRWINNRLSTIQLWLLHLITKQLMIPLNKNGHKWALMLTSLMTMLLTINLLGLLPYTFTPTTQLSMNMALAFPLWLATLLTGLRNKPSASLAHLLPEGTPTPLIPALILIETTSLLIRPLALGVRLTANLTAGHLLIQLISTASIALKPILPTVSILTMAILLLLTILEVAVAMIQAYVFVLLLSLYLQENI

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.026 kDa

MNLSFFDQFSSPYLMGMPLILPSLLLPTLLFPTPGRRWISNRLSTLQLWVINLITKQLMTPLNKTGHKWALLLTSLILLLLSINLMGLLPYTFTPTTQLSMNMALAFPLWLATLLIGLRNQPSASLAHLLPEGTPTPLIPILIMIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATIALLPTMPSISTLTALILLLLTILEVAVAMIQAYVFVLLLSLYLQENI

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.988 kDa

MMVSFFDQFASPSYLGIPNIAVAIALPWVLYPTPPARWINNRLITIQGWFINRFTNQLMLPLNVGGHKWALLLASLMIFLITINMLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMRNQPTIALGHLLPEGTPIPLIPVLIIIETISLLIRPLALGVRLTANLTAGHLLIQLIATAVFVLLPMMPTVAILTAAVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.093 kDa

MMTSFFDQFASPYLLGIPLILVAMLLPWLLFPAPTSRWINNRLITVQTWLTGRFTNQLMTPLNFSGHKWALLFASLMVFLITINLLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMKNQPTIALGHLLPEGTPIPLIPALIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVFVLLPMMPAVAILTASVLFLLTLLEVAVAMIQAYVFILLLSLYLQENI

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

25.108 kDa

MTLSFFDQFMSPTYLGIPLIAVALTLPWILFPTPSTRWLNNRLITLQGWFINRFTQQLLLPLNLGGHKWAVLLTSLMLFLITLNMLGLLPYTFTPTTQLSLNMGLAVPLWLATVIIGMRNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLMPIMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.382 kDa

MIMSFFDQFLSPSFLGIPLIALAISIPWLMFPTPTNRWLNNRLLTLQAWFINRFIYQLMQPMNLGGHKWAILFTALMLFLITINLLGLLPYTFTPTTQLSLNMAFALPLWLTTVLIGMFNQPTIALGHLLPEGTPTPLVPVLIIIETISLFIRPLALGVRLTANLTAGHLLMQLIATAAFVLLTMMPTVALLTSLVLFLLTILEVAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.077 kDa

MTLSFFDQFLSPTLFGIPLIALALLLPWTLFPAPSSRWVNSRLLTLQSWFINRFTQQLLLPLNMGGHKWGPYILLVMVFLISINMLGLLPYTFTPTTQLSVNMALAVPVWLMTVIIGLRKNPTAALGHLLPEGTPVPLIPALILIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLLPLMPTVAILTTILLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.931 kDa

MAMSFFDQFASPSYLGIPLIAIAIALPWVLFPLPSLRWVNNRLITIQGWLINRFTNQLMLPLNTGGHKWALLLASLMVFLITINMLGLLPYTFTPTTQLSLNMGLAIPLWLATVIIGLRNQPTVALGDLLPEGTPLPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVFVLLPMMPTVAILTATVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.05 kDa

MTLSLFDQFSSPSFLGIPMILMALALPWLLIPTPTSRWLSNRVVSLQGWFIARFTNQLFLPLNVGGHKWAPLLASLMMFLLTLNMLGLMPYIFTPTTQLSLNLGLAVPLWLATVLIGMRNQPTHALGHFLPEGTPTALIPILIIMQTISLFIRPLALGVRLTANLTAGHLLIHLISSAVFVLMPMMPVVAILTAVLLLLLTMLEVAVAMIQAYVFILLLSLYLQENV

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

25.363 kDa

MNLSFFDQFLSPSLLGIPLIAMAIMIPWLIFPTPTNRWLNNRLMTVQSWFINRFTYQLMQPMNFGGHKWATILTALMLFLITINLLGLLPYTFTPTTQLSLNMAFAIPLWLTTVLIGMLNQPTVALGHLLPEGTPTLLIPILIIIETISLFIRPLALGVRLTANLTAGHLLMQLIATAAFVLITIMPTVALLTSLILFLLTILEVAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

25.066 kDa

MMVSFFDQFASPSYLGIPLIAIAIALPWVLYPTSSSRWINNRLITIQGWFINRFTNQLMLPLNVGGHKWALLLASLMIFLITINMLGLLPYTFTPTTQLSLNMGFAVPLWLATVIIGMRNQPTVALGHLLPEGTPIPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAVFVLMPMMPTVAILTATVLFLLTLLEVAVAMIQAYVFVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.797 kDa

MNLSFFDQFSSPCLLGIPLILPSLLLPALLLPSPGNRWINNRLSTIQLWFTHLITKQLMTPLNKAGHKWALLLTSLILMLLSINLLGLLPYTFTPTTQLSMNMALALPLWLATLLTGLRNQPSASLGHLLPEGTPTPLIPALIMIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATIALLPMMPSISALTALILFLLTILEVAVAMIQAYVFVLLLSLYLQENI

mt-atp6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.25 kDa

MTLSFLDQFASQSFLGIPLIAIAILIPWMLFPSPYKRWMSNRLITFQSWFIARTTNQLMLPLNTGAHKWAMILTALLLFLMTLNLLGLLPYTFTPTTQLSMNMALAVPLWLATVLIGMRNQPTHSLAHLLPEGTPTPLIPILIIIETISLFIRPLALGVRLTANLTAGHLLIQLISTATFVMLSIMPTIATLTFIVLALLTILEIAVAMIQAYVLVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

227 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.048 kDa

MNLSFFDQFASPQLLGIPLILLSLLFPTLLLPSPNNRWINNRLSTLQLWFLQLITKQLMMPLNKAGHKWALILTSLMTFLLLINLLGLLPYTFTPTTQLSMNMALAFPLWLATLLTGLRNQPSISLGHLLPEGTPTPLIPALILIETTSLLIRPLALGVRLTANLTAGHLLIQLISTATLALLPTMPTISVLTATVLLLLTILELAVAMIQAYVFVLLLSLYLQENI

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.918 kDa

MNENLFASFTTPTMMGLPIVILIIMSPSIMFPSPNRLINNRLISIQQWLLQLTSKQMMSTHNNKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVLTGFRHKTKASLAHFLPQGTPTFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGGATLALMNISPTTSFITFITLVLLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.18 kDa

MNENLFAPFITPTVLGISVLPLIMIFPCLLFSTSNRWVPNRLIALQLWLVRLITKQMMMMHNKQGRMWTLMLITLIIFIASTNLLGLLPYTFTPTTQLSMNMGMAIPLWMGTVLMGFRNKPKASLAHFLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLIHLIGSATLALSSISLTVSTITFTILFLLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.758 kDa

MNENLFASFAAPTILGLPAAVLIILFPPLLVPTSKHLINNRLITTQQWLIQLTSKQMMTMHNTKGRTWSLMLVSLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTVVMGFRFKTKNALAHFLPQGTPTPLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGSATLALSTISLPSTLIIFTILILLTVLEIAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.77 kDa

MNENLFASFAAPTILGLPAAVLIILFPPLLVPTSKHLINNRLITTQQWLIQLTSKQMMTMHSTKGRTWSLMLVSLIIFITTTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGAVVMGFRFKTKNALAHFLPQGTPTPLIPMLVIIETISLLIQPMALAVRLTANITAGHLLMHLIGSATLALSTINLPYALIIFTILILLTILEIAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.865 kDa

MNENLFTSFSAPTILGQPATIPIIMFPTLLIPTSKHLINNQLTTVQQNLIKLTLKQMMAPHNAKGQSWSLMLMSLITFITMTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGTIITGLRFKTKNFLAHMLPQGTPTPLIPMLVMIETISLLIQPMALAVRLTANITAGHLLMHLIGNTMLTLSTINLSTTLLTSVLLMLLTILEIAVALIQAYVFTLLVNLYLHNNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.145 kDa

MNENLFAPFITPTILGITTLPIIITFPCLILSSPKRWLPNRIQILQMWLIRLITKQMMTMHNKQGRTWTLMLMSLILFIASTNLLGLLPYSFTPTTQLSMNIGMAIPLWAGTVIMGFRNKPKMSLAHFLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLIHLIGSATLALSSISMTVSTITFSILFLLTLLEIAVAMIQAYVFTLLVSLYLHDNS

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.78 kDa

MNENLFTSFITPTMMGLPIVILVIVFPAMLYPSPNRLINNRLISIQQWLVQLILKQMLLIHNSKGRTWALMLISLILFIGSTNLLGLVPYTFTPTTQLSMNLGMAIPLWAGAVITGFRHKAKASLAHFLPQGTPITLIPMLVVIETISLFIQPMALAIRLTANITAGHLLMHLIGGAVLALTSISPAAATITFIILLLLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.04 kDa

MNENLFSSFITPTLMGLPIIILIIMFPPVIMTSSKRLVNNRFHTFQQWLIKLITKQMMAIHSPKGRTWSLMLASLIIFIGSTNLLGLLPHTFTPTTQLSMNLGMAIPPWAGAVILGFRHKMKDSLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLTSISLPTAMITFIILIMLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.946 kDa

MNENLFASFATPTMMGLPIIMLIIMFPSILFPTPKRMITNRVVSVQQWLINMIMKQMMNIHNNKGRTWTLMLISLITFIGTTNLLGLLPHTFTPTTQLSMNLGMAIPLWAGAVVTGFRHKTKASLAHFLPQGTPIPLIPMLIIIQTISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMSISPTTASITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

mt-atp6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.943 kDa

MNLSFFDQFMSPVILGIPLIAIAMLDPFTLISWPIQSNGFNNRLITLQSWFLHNFTTIFYQLTSPGHKWALLLTSLMLLLMSLNLLGLLPYTFTPTTQLSLNMGLAVPLWLATVIMASKPTNYALGHLLPEGTPTPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLLSIMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.776 kDa

MNENLFASFIAPTILGLPAAVLIILLPPLLIPTSKYLINNRLIATQQWLIQLTSKQMMTMHNAKGRTWSLMLMWLIIFIATTNLLGLLPHSFTPTTQLSMNLAMAIPLWAGAVTTGFRSKTKNALAHLLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGSATLAMSTTNLPSTLIIFTVLILLTMLEIAVALIQAYVFTLLVSLYLHENT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.863 kDa

MNENLFASFTTPTMMGLPIVILIVLFPSILFPSPDRLINNRLTSIQQWLIQLTSKQMLSIHNHKGQTWALMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHKTKASLAHFLPQGTPLPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMDISTTTAFITFIVLILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.11 kDa

MNENLFASFITPTILGISILPLIMIFPCLLFSAPNRWMPNRLVALQLWLVRMVTKQMMSMHNKQGRMWTLMLITLIMFIASTNLLGLLPYTFTPTTQLSMNMGMAVPLWLGTVLMGFRNKPKSSLAHFLPQGTPTPLIPMLIIIETISLFIQPVALAVRLTANITAGHLLIHLIGSATLALSSISLTVSTITFTILFLLTILEIAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.842 kDa

MNENLFASFITPTIVGIPIVILIIMTPYIIFPSPTRLINNRLTSLQQWLVQLILKQLMSIHNTKGRTWSLMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAATVIKGFRHKTKASLAHFLPQGTPIPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLTSISPATASITFIILTLLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.158 kDa

MTMNMFEQFMSPELLMIPTALLSMLVPVLLIHHNPKLLGNRMTTAIAWLLMTIMSNMTNQLTPSGQKWCQVLTSLLLMILLSNLLGLLPYTFTSTSQLSMNMAMAIPLWMATIITGMTKKPSITLAHMLPEGSPTPLIPFMIIIETISLLMRPLALGVRLTANITAGHLLMTMVSTTTLNFITSHITLSIMTYLLLFLLCILELAVACIQAYVFVLLIILYLQENT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.746 kDa

MNENLFSSFATPTLMGLPIVALIIMFPTLLFPSPSRLINNRLVSTQQWLAQLILKQMMLMHSPKGRTWSLMLISLIMFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRYKTKASLAHFLPQGTPIPLIPMLIVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALALVSISPTTALITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

Mt-atp6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.076 kDa

MNENLFASFITPTMMGLPIVVTIIMFPSILFPSSERLISNRLHSFQHWLIKLIIKQMMLIHTPKGRTWALMIVSLIMFIGSTNLLGLLPHTFTPTTQLSMNLSMAIPLWAGAVILGFRHKLKNSLAHFLPQGTPISLIPMLIIIETISLFIQPMALAVRLTANITAGHLLMHLIGGATLVLMDISPPTATITFIILLLLTVLEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.987 kDa

MNENLFASFATPTMMGLPIVILIIMFPSILFPSSNRLINNRLISIQQWLVQLTSKQMMTIHNNKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVFMGFRHKTKAALAHFLPQGTPIFLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMDISPSTALITFIILILLTILEFAVAMIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.805 kDa

MNENLFASFTTPTMMGLPIVILIIMFPSILFPSPNRLINNRLVSLQQWLVQLTSKQMLAIHNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHKTKASLAHFLPQGTPVPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALALMNISTSIALITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.967 kDa

MNENLFAPFMIPVMLGIPITTLIIILPSILFPAPNRLINNRTISIQQWLTKLTSKQLMSVHSPKGQTWSLMLISLFLFIASTNLLGMLPHSFTPTTQLSMNVGMAIPLWAGTVATGFRNKTKMSLAHLLPQGTPTFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGETTLVLMSTSLFTAIITFTILALLTILEFRVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.072 kDa

MNENLFAPFMIPVMLGIPITTLIIILPSMLFPAPNRLINNRTIAIQQWLTKLTSKQLMNVHSPKGQTWSLMLISLFLFIASTNLLGMLPHSFTPTTQLSMNVGMAIPLWAGTVTTGFRNKTKMSLAHLLPQGTPTFLIPMLVIIETISLFIQPVAWAVRLTANITAGHLLMHLIGETTLALMNINLFSAFITFTILALLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.101 kDa

MNENLFATFITPTILGITTLPIIMLFPCLLLTSPKRWLPNRIQILQVWLIRLITKQMLTIHNKQGRSWALMLMSLILFIASTNLLGLLPYSFTPTTQLSMNIGMAIPLWLATVLMGFRNKPKISLAHFLPQGTPTPLVPMLIIIETISLFIQPVALAVRLTANITAGHLLIHLIGSATLALCSISVTVSTITFIILFLLTILELAVAMIQAYVFTLLVSLYLHDNS

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.798 kDa

MNENLFASFITPMMFGLPLVTLIVLFPSLLFPTSNRLVNNRLISLQQWMLQLVSKQMMSIHNTKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWGGAVITGFRNKTKASLAHFLPQGTPTPLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLALMSINTTTALITFIILILLTVLEFAVAMIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.789 kDa

MNENLFASFAAPSMMGLPIVVLIVMFPSILFPTPSRLINNRLISIQQWLIQLTSKQMLAIHNQKGRTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRYKTKASLAHFLPQGTPLPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALINISATTAFITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.789 kDa

MNENLFASFAAPSMMGLPIVVLIVMFPSILFPTPSRLINNRLISIQQWLIQLTSKQMLAIHNQKGRTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRYKTKASLAHFLPQGTPLPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALINISATTAFITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.917 kDa

MNENLFTSFITPMMLGLPLVTLIILFPSLLFPSSNRLINNRLVSLQQWALQLMSKQMMSIHNTKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTKASLAHFYPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALTSISPTTALITFIILILLTILEFELGTREAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.918 kDa

MNENLFTSFATPTIMGLPIVILIIMFPSIMFPSPNRLINNRLVSTQQWLLQLTSKQMLSIHNNKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVFLGFRHKTKASLAHFLPQGTPVFLIPMLVIIETISLFIQPVALAVRLTANITAGHLLMHLIGGATLALMNISPTTALITFIILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.794 kDa

MNENLFASFATPTMMGLPIVILIVLFPSILFPSPDRLINNRLASIQQWLIQLTSKQMLSIHNRKGQTWALMLISLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHKTKASLAHFLPQGTPLPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALMDISTATAFITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

25.039 kDa

MNENLFASFIAPTMMGLPIVTLIIMFPSLLFPTPKRLINNRTISIQQWLIQLTSKQMMAIHNQKGQTWSLMLMSLIMFIGSTNILGLLPHSFTPTTQLSMNLGMAIPLWSATVFTGFRYKTKTSLAHFLPQGTPALLIPMLVIIETISLFIQPVALAVRLTANITAGHLLIHLIGGATLALLNINTMTAFITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.801 kDa

MNESLFTPFITPTVLGLPAAVLVILFPPLLIPTSKHLINNRLIIIQQWLIRLILKQMMTTHNAKGRTWSLMLTSLIIFIASTNLLGLLPYSFTPTTQLSMNLAMAIPLWASTVAMGLRFKAKITLTHLLPQGTPTPLIPMLIIIETVSLFIQPLALAVRLTANITAGHLLMHLIGSSALAMLAINLPLTLITLTILTLLTILETAIALIQAYVFTLLVSLYLHDNS

MT-ATP6

ATP synthase subunit a

226 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.933 kDa

MNEDLFTPFTTPTVLGLPAAILVILFPPLLVPTSKHFINNRLITTQQWLIRLTLKQMMITHNTKGRTWSLMLTSLIIFIASTNLLGLFPYSFTPTTQLSMNLAMAIPLWASTVAMGLRFKAKISLAHLLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLMHLIGSATLTMLTINLPLTLITLTILTLLTILEIAVALIQAYVFTLLVSLYLHDNS

MT-ATP6

ATP synthase subunit a

225 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.883 kDa

MNLFDQFLTPSLLGISLLMPALLMTTILLLNPKNQWLSHPTTTIKSWFINQAAKQIMTPINPTGHKHSLILISLLILLSLTNLLGLLPYTFTPTTQLSMNMAIALPLWLVTVLIGLRTQPTTSLAHLLPEGTPMLLIPILILIETISLLIRPIALGVRLTANLTAGHLLIQLISIATLNLWFMMPPLSLLTSTVLILLLLLEFAVAMIQAYVFVLLLSLYLQENS

mt-atp6

ATP synthase subunit a

223 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.597 kDa

MTLSFFDQFMSPTYLGIPLIAVALTLPWILFPTPSARWLNNRLITLQGWFINRFTQQLLLPLNLGGHKWAALLTSLMLFLITLNMLGLLPYTFTPTTQLSLNMGLAVPLWLATVIIGMRNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPALGVRLTANLTAGHQLIATAAFVLLPMMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

222 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.576 kDa

MNEELSTFFYVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNTKGLSWSLMLITLTLFIGLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVPGFRYKTKISLAHLLPQGTPMFLIPMIIIIETISLLIRPVTLAVRLTANITAGHSLIHLTGTATLTLSSIHSMTITVTFVTVILLTILELAVALIQAYVFALLISLYLHENA

MT-ATP6

ATP synthase subunit a

222 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.539 kDa

MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNMKGLSWSLMLITLTLFIGLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVLGFRYKTKISLAHLLPQGTPTFLIPMIIIIETISLLIRPITLAVRLTANITAGHLLIHLTGSAALTLLSVHLMTITVTFITVVMLTILELAVALIQAYVFALLISLYLHESA

MT-ATP6

ATP synthase subunit a

222 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.435 kDa

MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLVKLIMKQLLSIHNTKGLSWSLMLITLTLFIGLTNLLGLLPYSFAPTAQLTVNLSMAIPLWTGTVILGFRYKTKISLAHLLPQGTPTFLIPMIIIIETISLLIRPVTLAVRLTANITAGHLLIHLTGTAALTLLSIHSMTITVTFITVVVLTILELAVALIQAYVFALLISLYLHESA

MT-ATP6

ATP synthase subunit a

220 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.403 kDa

MSLNFFDQFMSPTLLGVPLIAVAMMFPWTLLPTPTNRWLNNRTLTLQNWFIGRFTNQLLQPLNTGGHKWAMILMSLNLLGLLPYTFTPTTQLSLNMGLAIPFWLATVLLGLRNQPTAALGHLLPEGTPTLLIPILIIIETISLLIRPFALGVRLTANLTAGHLLMQLIATAAFVLLPMMPTVALLTTLVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

mt-atp6

ATP synthase subunit a

219 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

24.061 kDa

single

FMSPTYLGIPLIAVALTLPWILFPTPSARWLNNRLITLQGWFINRFTQQLLLPLNLGGHKWAALLTSLMLFLITLNMLGLLPYTFTPTTQLSLNMGLAVPLWLATVIIGMRNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLLPLMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

MT-ATP6

ATP synthase subunit a

217 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

25.442 kDa

MTTNLFNIFDPSTTIFNLEMNWISTLLIILFMPNFLWILPNRMNWLLFKMFNMLNNEMLMLYKMKKTKSPAFLFISLFMFILLNNFFSLFPYIFSSSSHMVFSVTLAIPFWMFFIILSTCKNTKNMIAHLIPLNTPIYLAPLMTIIETMSIIIRPMSLSIRLTANLIAGHLLMTLLNFNSLMIIIIFIQMFMMIFELCVALIQSYVFSILSSLYSSE

MT-ATP6

ATP synthase subunit a

212 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane (By similarity).

Belongs to the ATPase A chain family.

23.225 kDa

single

PQMMGIPLILIAIFLPTLLIYTSPTRLSTNRMTTLQLWLTNTITKQLFLPVNTPGHKWAAMLMTLMIXLLSMNLLGLLPYTFTPTTQLSMNMALAIPLWLATVLTGLRNQPTASLGHLLPEGTPTPLIPLLIIIETVSLFIRPLALGVRLTANLTAGHLLIQLISTAAFVLLPMMTLTALSTFIVLVLLTGLEIAVAMIQAYVFTLLLTLYL

MT-ATP6

ATP synthase subunit a

212 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

23.227 kDa

single

PQMMGIPLILIAIILPMLLMFTSSTRLSSNRMTTMQLWVMNTITKQLFLPVNMPGHKWAAMLITLMIFLLSMNMLGLLPYTFTPTTQLSMNMALAAPLWLATVLTGLRNQPTASLGHLLPEGTPTPLIPLLIIIETVSLFIRPLALGVRLTANLTAGHLLIQLISTAAFVLMPTMPMAALSTLIVLMLLTGLEIAVAMIQAYVFTLLLTLYL

mt-atp6

ATP synthase subunit a

133 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

14.982 kDa

single

LALTLPWVLFPTPTSRWLNNRLLTLQNWFIGRFGHELFTPVNLPGHKWAVLLTSLMLFLISLNMLGLLPYTFTPTTQLSLNMGLAFPLWLATVIIGMRNQPTEALGHLLPEGTPTLLIPVLIVIETISLFIRP

mt-atp6

ATP synthase subunit a

105 amino acids

Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Key component of the proton channel; it may play a direct role in the translocation of protons across the membrane.

Belongs to the ATPase A chain family.

11.291 kDa

single

RNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFVLLPMMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYL