Msrb3

Methionine-R-sulfoxide reductase B3, mitochondrial

253 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine.

Belongs to the MsrB Met sulfoxide reductase family.

26.832 kDa

MPPAAPSVARSREGGGIGQRRLVFPKSARRTLPCPIALCLGLCLAAAAATTTRASAAAFASAGDTTAMSAFNLLHLVTKSQPVAPRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPAFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLSFTPADSSEAEGSGIKESGSPAAADRAEL

Msrb3

Methionine-R-sulfoxide reductase B3, mitochondrial

253 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine.

Belongs to the MsrB Met sulfoxide reductase family.

26.832 kDa

MPPAAPSVARSREGGGIGQRRLVFPKSARRTLPCPIALCLGLCLAAAAATTTRASAAAFASAGDTTAMSAFNLLHLVTKSQPVAPRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPAFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLSFTPADSSEAEGSGIKESGSPAAADRAEL

MSRB3

Peptide methionine sulfoxide reductase B3, chloroplastic

229 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).

Belongs to the MsrB Met sulfoxide reductase family.

24.685 kDa

MGVQHLLKLRMASPHPHPHPGAPLAARPLSALASFFLARPSSTAAAPPPRHVTLSCSRPHCNHNQWAASRCRGTAGRRRLQVVVAMSSSAPPPPPGSVQKSEEEWEAILSPEQFRILRLKGTEYPGTGEYDKLFAEGVYECAGCGTPLYKSSTKFNSGCGWPAFYEGFPGAIARTPDPDGRRIEITCAACGGHLGHVFKGEGFNTPTDERHCVNSISLKFIPASEDSKL

MSRB3

Peptide methionine sulfoxide reductase B3, chloroplastic

229 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).

Belongs to the MsrB Met sulfoxide reductase family.

24.685 kDa

MGVQHLLKLRMASPHPHPHPGAPLAARPLSALASFFLARPSSTAAAPPPRHVTLSCSRPHCNHNQWAASRCRGTAGRRRLQVVVAMSSSAPPPPPGSVQKSEEEWEAILSPEQFRILRLKGTEYPGTGEYDKLFAEGVYECAGCGTPLYKSSTKFNSGCGWPAFYEGFPGAIARTPDPDGRRIEITCAACGGHLGHVFKGEGFNTPTDERHCVNSISLKFIPASEDSKL

MSRB3

Methionine-R-sulfoxide reductase B3

192 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.

Belongs to the MsrB Met sulfoxide reductase family.

20.702 kDa

MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

MSRB3

Methionine-R-sulfoxide reductase B3

192 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.

Belongs to the MsrB Met sulfoxide reductase family.

20.702 kDa

MSPRRTLPRPLSLCLSLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL

MSRB3

Methionine-R-sulfoxide reductase B3

190 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine.

Belongs to the MsrB Met sulfoxide reductase family.

20.489 kDa

MSPQRTLPRPLSLCLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVISSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGAAEGESGVASPAQADKAEL

MSRB3

Methionine-R-sulfoxide reductase B3

190 amino acids

Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine.

Belongs to the MsrB Met sulfoxide reductase family.

20.489 kDa

MSPQRTLPRPLSLCLCLCLCLAAALGSAQSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVISSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGAAEGESGVASPAQADKAEL

MSRB3

Peptide methionine sulfoxide reductase B3

176 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. Involved in cold tolerance. Eliminates MetSO and reactive oxygen species that accumulate at the ER during cold acclimation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).

Belongs to the MsrB Met sulfoxide reductase family.

18.847 kDa

MNIVNSKILFLSFTLLLLLQSSIVESDSICLSSGVASTVAMAAPGSVQKGDEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGWPAFFEGIPGAITRTTDPDGRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSLKFTPAASSL

MSRB3

Peptide methionine sulfoxide reductase B3

176 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. Involved in cold tolerance. Eliminates MetSO and reactive oxygen species that accumulate at the ER during cold acclimation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).

Belongs to the MsrB Met sulfoxide reductase family.

18.847 kDa

MNIVNSKILFLSFTLLLLLQSSIVESDSICLSSGVASTVAMAAPGSVQKGDEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGWPAFFEGIPGAITRTTDPDGRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSLKFTPAASSL