MSRB2

Peptide methionine sulfoxide reductase B2, chloroplastic

202 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.

Belongs to the MsrB Met sulfoxide reductase family.

21.968 kDa

MAFNIITPGRVYSATSLTFVSTIKAAFVKPPLASPSRRNLLRFSSSPLSFPSLRRGFHGGRIVAMGSSAPESVNKPEEEWRAILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGWPAFFDGLPGAITRTPDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFTPENPTL

MSRB2

Peptide methionine sulfoxide reductase B2, chloroplastic

202 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Specifically reduces the MetSO R-enantiomer. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May play an essential function in association with MSRB1 in maintaining vegetative growth during environmental constraints, through the preservation of photosynthetic antennae. MSRB1 and MSRB2 account for most of the leaf peptide MSR capacity.

Belongs to the MsrB Met sulfoxide reductase family.

21.968 kDa

MAFNIITPGRVYSATSLTFVSTIKAAFVKPPLASPSRRNLLRFSSSPLSFPSLRRGFHGGRIVAMGSSAPESVNKPEEEWRAILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGWPAFFDGLPGAITRTPDPDGRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISLKFTPENPTL

MSRB2

Methionine-R-sulfoxide reductase B2, mitochondrial

182 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.536 kDa

MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH

MSRB2

Methionine-R-sulfoxide reductase B2, mitochondrial

182 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.536 kDa

MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH

msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

180 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.999 kDa

MSRFLVRLSTVVSKGATGKSVLPQKRIFAGIRLISSSTGLQSLTRYDQSTDWQRKLSPEQYVVTREKGTEVPFSGIYLNHNEVGMYHCVCCDSPLFSSEAKYDAGAGWPSFCEAHGTWEKDESHANIVRRPDNSLGSTGTEVICKHCDAHLGHVFEDGPDPTGQRFCINSVALNFKPREK

msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

180 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.999 kDa

MSRFLVRLSTVVSKGATGKSVLPQKRIFAGIRLISSSTGLQSLTRYDQSTDWQRKLSPEQYVVTREKGTEVPFSGIYLNHNEVGMYHCVCCDSPLFSSEAKYDAGAGWPSFCEAHGTWEKDESHANIVRRPDNSLGSTGTEVICKHCDAHLGHVFEDGPDPTGQRFCINSVALNFKPREK

Msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

175 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.157 kDa

MARLLRALRGLPLLQAPGRLARGCAGSGSKDTGSLTKSKRSLSEADWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAYGSKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPKPTGQRFCINSVALKFKPSKP

Msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

175 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.157 kDa

MARLLRALRGLPLLQAPGRLARGCAGSGSKDTGSLTKSKRSLSEADWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAYGSKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPKPTGQRFCINSVALKFKPSKP

Msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

174 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.073 kDa

MARLLRALRGLPWLEAPGRARGCAGSGRGDTGSLIKSKLSLSKADWQKKLTPEQFYVTREKGTEAPFSGMYLKNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPDPTGQRFCINSVALKFKPSKP

Msrb2

Methionine-R-sulfoxide reductase B2, mitochondrial

174 amino acids

Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases, methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residue. Upon oxidative stress, may play a role in the preservation of mitochondrial integrity by decreasing the intracellular reactive oxygen species build-up through its scavenging role, hence contributing to cell survival and protein maintenance.

Belongs to the MsrB Met sulfoxide reductase family.

19.073 kDa

MARLLRALRGLPWLEAPGRARGCAGSGRGDTGSLIKSKLSLSKADWQKKLTPEQFYVTREKGTEAPFSGMYLKNKETGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTKGSDESHTGILRRLDTSLGCPRMEVVCKQCEAHLGHVFPDGPDPTGQRFCINSVALKFKPSKP

msrB2

Peptide methionine sulfoxide reductase MsrB 2

147 amino acids

Belongs to the MsrB Met sulfoxide reductase family.

16.534 kDa

MTYRKTDEEVSKLTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWPSFTKPIVPANVNELRDNSHGMIRTEVRSAHGDSHLGHVFPDGPQDRGGLRYCINSAALRFIPREEMEAEGYGGYFNQVEDI

msrB2

Peptide methionine sulfoxide reductase MsrB 2

147 amino acids

Belongs to the MsrB Met sulfoxide reductase family.

16.534 kDa

MTYRKTDEEVSKLTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWPSFTKPIVPANVNELRDNSHGMIRTEVRSAHGDSHLGHVFPDGPQDRGGLRYCINSAALRFIPREEMEAEGYGGYFNQVEDI