MSRA3

Peptide methionine sulfoxide reductase A3

202 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. May prevent cellular oxidative damage due to light exposure. MSRA family specifically reduces the MetSO S-enantiomer.

Belongs to the MsrA Met sulfoxide reductase family.

22.545 kDa

MNILNRLGLGSSGQTNMDPSPIAQGNDDDTPAPGNQFAQFGAGCFWGVELAFQRVPGVTQTEAGYTQGTVDNPSYGDVCSGTTGHSEVVRVQYDLNDCTYESLLDLFWSRHDPTTLNRQGNDVGTQYRSGIYFYTPEQEKLARESLERHQQQMERKIMTEILPAKKFYRAEEHHQQYLSKGGRFGQGQSTAKGCNDPIRCYG

msrA3

Peptide methionine sulfoxide reductase MsrA 3

168 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.344 kDa

MTKRAVLAGGCFWGMQDLIRKLPGVIETRVGYTGGDVPNATYRNHGTHAEGIEIIFDPERISYRRILELFFQIHDPTTKDRQGNDIGTSYRSAIYYVDDEQKRIAQETIADVEASGLWPGKVVTEVEPVRDFWEAEPEHQNYLERYPNGYTCHFPRPNWVLPRRSAAE