About Services Proteins Contact

MSMEG_6921

Gene
MSMEG_6921
Protein
UPF0301 protein MSMEG_6921/MSMEI_6732
Organism
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Length
201 amino acids
Similarity
Belongs to the UPF0301 (AlgH) family.
Mass
22.094 kDa
Sequence
MAQSEDPEDFIAPAAHRVRPGTLLLANTDLLEPTFRRTVIYIVEHNSGGTLGVILNRPSETAVYNVLPQWAEVTAKPKTMFIGGPVKRDSALCLATLRVGMQADGVDGLRHVQGRVVMVDLDADPEELAPVIEGVRIFAGYSGWTTGQLDGEIERDDWIVLSALPSDVLIEPRIDLWGRVLRRQPLPMSLLATHPIDVSRN