MS4A3

Membrane-spanning 4-domains subfamily A member 3

214 amino acids

Hematopoietic modulator for the G1-S cell cycle transition. Modulates the level of phosphorylation of cyclin-dependent kinase 2 (CDK2) through its direct binding to cyclin-dependent kinase inhibitor 3 (CDKN3/KAP).

Belongs to the MS4A family.

22.933 kDa

MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV

Ms4a3

Membrane-spanning 4-domains subfamily A member 3

213 amino acids

Hematopoietic modulator for the G1-S cell cycle transition. Modulates the level of phosphorylation of cyclin-dependent kinase 2 (CDK2) through its direct binding to cyclin-dependent kinase inhibitor 3 (CDKN3/KAP) (By similarity).

Belongs to the MS4A family.

22.872 kDa

MKPEETGGSVYQPLDESRHVQRGVLQALGAIQILNGILILALGIFLVCLQHVSHHFRHFFFFTFYTGYPLWGAVFFISSGSLTVAAGRNPTRMLMQNSFGINIASTTIAFVGTVFLSVHLAFNTQAFKGCQSSPSPDVCISLGSSSDGLVSLMLILTLLELSVTISISAMWCLGNVCGLREAITSPPNSVESGILPEGSDSENLNTQPQASEE