MS4A2

High affinity immunoglobulin epsilon receptor subunit beta

244 amino acids

High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.

Belongs to the MS4A family.

26.534 kDa

MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL

Ms4a2

High affinity immunoglobulin epsilon receptor subunit beta

243 amino acids

High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.

Belongs to the MS4A family.

26.731 kDa

MDTENKSRADLALPNPQESPSAPDIELLEASPPAKALPEKPASPPPQQTWQSFLKKELEFLGVTQVLVGLICLCFGTVVCSTLQTSDFDDEVLLLYRAGYPFWGAVLFVLSGFLSIMSERKNTLYLVRGSLGANIVSSIAAGLGIAILILNLSNNSAYMNYCKDITEDDGCFVTSFITELVLMLLFLTILAFCSAVLLIIYRIGQEFERSKVPDDRLYEELHVYSPIYSALEDTREASAPVVS

Ms4a2

High affinity immunoglobulin epsilon receptor subunit beta

235 amino acids

High affinity receptor that binds to the Fc region of immunoglobulins epsilon. Aggregation of FCER1 by multivalent antigens is required for the full mast cell response, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. Also mediates the secretion of important lymphokines. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators responsible for the manifestations of allergy.

Belongs to the MS4A family.

25.963 kDa

MDTENRSRADLALPNPQESSSAPDIELLEASPAKAAPPKQTWRTFLKKELEFLGATQILVGLICLCFGTIVCSVLYVSDFDEEVLLLYKLGYPFWGAVLFVLSGFLSIISERKNTLYLVRGSLGANIVSSIAAGTGIAMLILNLTNNFAYMNNCKNVTEDDGCFVASFTTELVLMMLFLTILAFCSAVLFTIYRIGQELESKKVPDDRLYEELNVYSPIYSELEDKGETSSPVDS