mrt4

Ribosome assembly factor mrt4

252 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

28.329 kDa

MPKSKRAKVYNLTQVTKKNREQKEKLFENIRECIPNYQHCFVFSIDNMRNNYLKDVRKELNDCRIFFGKTKLTARALGTTPEDAQADGLDKLSKYLSGSVGLIFTNRDPSEIKDYFVNLTQVDFARAGSVATRTITIPSGPLYSTGGEVPAEHDVPVSHTLEPELRRLGMPTRMVKGKVCLGDEAGEGDDYVICKEGETLDSRQTRLLKLFSICLSEFRVKLLAYWSAASGEVTELEKPGEAGAEEMEEDDE

mrt4

Ribosome assembly factor mrt4

241 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

26.664 kDa

MPKSRRSKVLTLAQTEKKGHEGKAALFSGVQQSLDSFDYMWIFDVTNMRNTYLKRIRDDWKGSRIFMGKTKVMAKALGHTPEEEHAENVSKLTKLLHGAVGLLFTNSKPDEVIGYFESFVQNDFARAGAVAPFTHVIPAGPVYSRAGQIPVEDDILLTHTLEPQVRQLGMPTVLKNGVVTLLADFPLCTEGQQLDSRQTRLLKLFGITAAEFKVGLLGYYSKKGASVEFLQSAPGADEAME

MRT4

Ribosome assembly factor mrt4

239 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

27.381 kDa

MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQLDDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLFTNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEPTLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIISAYYDNESSTVSELNINKKQDA

MRT4

Ribosome assembly factor mrt4

236 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

26.879 kDa

MPRSKRSKLVTLAQTEKKGRENKERIFDEVRQALDTYRYVWVLRLEDVRTPVLQEIRSAWAGSKLIMGRRKVLEKALGGTRETEYKENVSGLVKQCEGMCGLLFTDETPETVTAYFREYRKADYSRAKSRAPLRVEIPAGVVYSRGGQVPAEDDVPMVHSLEPTLRNKFKMPTRIQNGKITLEQPYLVCEAGETLDVRQALILKQFGVAAAEFRVKLAAYYDGEAAAVEEVRINME

MRT4

Ribosome assembly factor MRT4

236 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

27.058 kDa

MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYRYVWVLHLDDVRTPVLQEIRTSWAGSKLIMGKRKVLQKALGEKREEEYKENLYQLSKLCSGVTGLLFTDEDVNTVKEYFKSYVRSDYSRPNTKAPLTFTIPEGIVYSRGGQIPAEEDVPMIHSLEPTMRNKFEIPTKIKAGKITIDSPYLVCTEGEKLDVRQALILKQFGIAASEFKVKVSAYYDNDSSTVESTNINME

mrt4

Ribosome assembly factor mrt4

223 amino acids

Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.

Belongs to the universal ribosomal protein uL10 family.

25.836 kDa

MVKSKRNVVVNMTKVTKNPGEKKKKLVSTIKDIVDQYKFIYLFTFENMRNNKLKSVRTEWSTSKFLFGKNKVLSVGLGKSEEDELKPNLHKLTEHLEGECGLFFTNEPKDKVFEYFTNYSEKDFPRSGFVSEETITIKEGPIVGMTHSMETYLRGLGLPTTLKNGVIFVDREYTLCEAGVAVTPEQSQLLKLFNHEISEFKFHIKGFWNEDEFTLCEEESQEE